KEGG   Chelonia mydas (green sea turtle): 102944012Help
Entry
102944012         CDS       T02989                                 

Gene name
KCNJ1
Definition
(RefSeq) potassium voltage-gated channel subfamily J member 1
  KO
K04995  potassium inwardly-rectifying channel subfamily J member 1
Organism
cmy  Chelonia mydas (green sea turtle)
Brite
KEGG Orthology (KO) [BR:cmy00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:cmy04040]
    102944012 (KCNJ1)
Ion channels [BR:cmy04040]
 Voltage-gated cation channels
  Potassium channel, inwardly-rectifying (Kir)
   102944012 (KCNJ1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IRK_C IRK DUF2182 CrgA
Motif
Other DBs
NCBI-GeneID: 102944012
NCBI-ProteinID: XP_007066421
UniProt: M7BBS0
Position
Un
AA seq 359 aa AA seqDB search
MFKYFRKRFASHLTERCRRRARLVSKDGRCNIEFGNVEEQSRFVFLIDIWTTILDLRWRY
KMTIFISAFLGSWFLFGLLWYVVAYIHKDLPEFSPSINHTPCVQNINGLTSAFLFSLETQ
VTIGYGFRYVTAILGVIINSFMCGAILAKISRSKKRAKTITFSKNAVISKRGGKLCLLIR
VANLRKSLLIGSHIYGKLLKTTITPEGETIILDQVNIDFVVDAGNENLFFISPLTIYHII
DKTSPFFHMSVETILQQDFELVVFLDGTVEATSATCQVRTSYIPEEVLWGYRFAPIVSKT
KEGKYRVDFHNFSKTVEVETPHCAFCLYNEKDAKAKAKRGYDNPGFILSEVNETSDTKM
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgttcaaatacttccggaagcgctttgccagccatctgacggaacgctgtcgccgaaga
gcaaggctggtatctaaagatggaaggtgtaacatagagtttgggaacgtggaagaacag
tcacggtttgtcttcttgattgatatatggaccaccatcctggacctaagatggagatac
aagatgaccatcttcatctcagcattcttaggcagttggttcctatttggtctcctttgg
tacgttgtggcatatatacataaagatcttcctgaattcagtccttccataaaccacacc
ccatgtgtgcagaacataaacggcttgacctctgctttcctgttctccctggaaacccag
gttaccattggctatggcttcaggtatgtcacagctatccttggggtcatcatcaactct
ttcatgtgtggcgctatcttggctaagatttctaggtccaagaaacgggccaagaccatc
accttcagcaagaatgcggtcattagcaaacgaggcggcaagctgtgcctccttatccgg
gtggccaaccttaggaagagtctactgattgggagccacatctatgggaagcttctgaag
accaccatcactccagaaggagagactatcatcttggaccaggtcaacatagactttgtg
gtggatgctggcaatgagaacctcttcttcatctcccccttgactatttaccacatcatt
gataagaccagcccgttcttccacatgtcagtggaaaccatcctccagcaggattttgag
ctagtggtatttttagatggtacagtggaggccactagtgctacctgtcaggtcaggaca
tcctatatcccagaggaggtactctggggctaccgttttgctcccattgtgtccaagacc
aaggaagggaagtatagagtagacttccacaacttcagcaagaccgtggaagtagagact
cctcactgtgccttttgcctctacaatgagaaggatgctaaagcgaaggcaaagagaggt
tacgacaaccctggcttcattctatcagaagtcaatgaaaccagcgacacaaaaatgtag

DBGET integrated database retrieval system