KEGG   Chelonia mydas (green sea turtle): 102945511Help
Entry
102945511         CDS       T02989                                 

Gene name
DUSP10
Definition
(RefSeq) dual specificity phosphatase 10
  KO
K20216  dual specificity phosphatase 10 [EC:3.1.3.16 3.1.3.48]
Organism
cmy  Chelonia mydas (green sea turtle)
Pathway
cmy04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:cmy00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102945511 (DUSP10)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cmy01009]
    102945511 (DUSP10)
Enzymes [BR:cmy01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     102945511 (DUSP10)
    3.1.3.48  protein-tyrosine-phosphatase
     102945511 (DUSP10)
Protein phosphatases and associated proteins [BR:cmy01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   MAPK phosphatases
    102945511 (DUSP10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DSPc Rhodanese PTPlike_phytase Y_phosphatase Init_tRNA_PT Herpes_UL7
Motif
Other DBs
NCBI-GeneID: 102945511
NCBI-ProteinID: XP_007064803
UniProt: M7BSP6
Position
Un
AA seq 480 aa AA seqDB search
MPPSPLDDRVVVALSRPVRPQDLNLCLDSSYLESASSASESHTSLLGTAVVSLKAANLTY
MPSSNSSARSLSCGCSSASCCTVATYDKDNQAQTQASTSSTTNVGTSTTCPANQMVNNNE
NTGALSPSGGVGSPASGTTKQLASIKVIYPNDLAKKMTKCNKSHQQNQGPVIIDCRPFME
YNKSHIQGAVHINCSDKISRRRLQQGKITVLDLISCREGKDSFKRIFSKEIIVYDENTNE
PSRVMPSQPLHIVLESLKREGKEPLVLKGGLSSFKQNHENLCDNSLQLQECPEGGGGASA
VPATLPQSIPTTPDIENAELTPILPVLFLGNEHDAQDLEKMQRMNIGYVINVTTHLPLYH
YEKGLFNYKRLPATDSNKQNLRQYFEEAFEFIEEAHQCGKGLLIHCQAGVSRSATIVIAY
LMKHTRMTMTDAYKFVKGKRPIISPNLNFMGQLLEFEEDLNNGVTPRILTPKLIGVETVV
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgcctccatctcctttagacgacagggtagtagtggcactttcaaggccagtaagacct
caggatctcaacctttgtttagactctagctaccttgaatctgcttcttctgccagtgag
agtcacacaagtctccttggcacagctgttgtgtccctaaaggctgctaatctcacgtat
atgccctcatccaacagctctgcacgctctctgagttgtggatgcagcagcgccagttgc
tgcactgtggcaacttacgacaaggacaatcaggcccaaactcaagcaagcaccagcagc
actaccaacgtaggaacctctaccacctgccctgctaaccaaatggtcaacaacaatgag
aacacgggcgcattgagtccatcgggtggagtggggagcccggcctcaggcacaaccaag
caactagctagcataaaggtaatctaccctaatgacctggctaaaaagatgaccaaatgc
aacaagagccaccaacagaaccaagggcctgtcatcattgactgcaggccattcatggag
tacaataagagtcacattcaaggggctgttcacattaactgttctgacaagatcagcagg
agaaggctccagcagggcaagatcacggtcttggacttgatctcctgccgggaaggcaag
gactccttcaagaggatcttttccaaagaaattatagtttatgatgagaataccaatgag
ccaagccgagtaatgccttcccagccactccacatagtgctggagtcactcaagcgagaa
ggcaaggaacctctagttctgaaaggtggactcagcagttttaaacagaaccacgaaaac
ctctgtgataactccctccaacttcaggagtgcccagaaggcggaggaggtgcatctgcg
gtgccggccacactacctcagtccatccccaccactccggacatagagaatgcggagctg
acccccatcttgcccgtcctcttccttggaaatgagcatgatgctcaggacttggagaag
atgcagaggatgaacataggatacgtaatcaacgtgaccacccacctccccctctaccat
tacgagaaaggcttgttcaactacaagcggctccctgccactgacagcaacaagcagaat
ctcaggcagtacttcgaagaggcttttgaattcattgaggaagctcaccagtgtggaaaa
ggcctccttattcactgtcaggccggtgtgtcgcgctctgccaccatcgtcatcgcttac
ttaatgaagcacacgcggatgaccatgacggatgcctataaatttgtcaaaggcaaacga
cccatcatttctcctaatcttaactttatggggcagttactggagtttgaagaagatcta
aataatggcgttaccccacgaattctcacaccaaagctgattggtgtggagactgttgtg
tga

DBGET integrated database retrieval system