KEGG   Chelonia mydas (green sea turtle): 102946725
Entry
102946725         CDS       T02989                                 

Gene name
ADCY4
Definition
(RefSeq) adenylate cyclase 4
  KO
K08044  adenylate cyclase 4 [EC:4.6.1.1]
Organism
cmy  Chelonia mydas (green sea turtle)
Pathway
cmy00230  Purine metabolism
cmy01100  Metabolic pathways
cmy04020  Calcium signaling pathway
cmy04114  Oocyte meiosis
cmy04261  Adrenergic signaling in cardiomyocytes
cmy04270  Vascular smooth muscle contraction
cmy04371  Apelin signaling pathway
cmy04540  Gap junction
cmy04912  GnRH signaling pathway
cmy04914  Progesterone-mediated oocyte maturation
cmy04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:cmy00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    102946725 (ADCY4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    102946725 (ADCY4)
   04020 Calcium signaling pathway
    102946725 (ADCY4)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    102946725 (ADCY4)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    102946725 (ADCY4)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    102946725 (ADCY4)
   04914 Progesterone-mediated oocyte maturation
    102946725 (ADCY4)
   04916 Melanogenesis
    102946725 (ADCY4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102946725 (ADCY4)
   04270 Vascular smooth muscle contraction
    102946725 (ADCY4)
Enzymes [BR:cmy01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     102946725 (ADCY4)
SSDB
Motif
Pfam: Guanylate_cyc AC_N DUF1053 CD52 HNOBA
Other DBs
NCBI-GeneID: 102946725
NCBI-ProteinID: XP_007069374
Position
Un
AA seq 979 aa
MGYIFVFTSGVVSAWDQVSFFLFIIFTVYTMLPVCMRDAVVAGLASSLSHIIVLGVYLSA
GRGSRAELAVQLLANAVIFICGNLVGAYHKHLMEVALQETFQETFKLIQSRVKLESEKRH
QEHLLLSILPAYIAMEMKAEIIERLRDGGRQESANNFHNLYVKHHKNVSILYADIVGFTR
LASECSPKELVLMLNELFGKFDQIAKDNECMRIKILGDCYYCVSGLPVSLPNHARNCVKM
GLDMCQAIKKLRDATGVDINMRVGVHSGNVLCGVIGLQKWQYDVWSHDVTLANHMEAGGV
PGRVHITEATLSHLGGVYAVEETCRWQRDPFLKENKVKTFLVIDPWVGAESCNNTLSPVP
GEGQKMRASVRMTRYLESWGAAKPFANLKHLDPPPADQPGFTRNNHSESSLGSLTQSKTV
ERVRSPKGPDEELDGVDEKFFQVLEQLNSQKQWKKSEDFNRITLYFKEKLMEKEYRLSAL
PAFKYYTACTFLVFLSNFLIQMLVAHKTPALGISYGISFFLFILLLFTCFAGNLAKCFQK
GPKMLYWVPSLSTAVCTQPWLRVTLGVTTILVVLTMAMFNFFFIPTPWCPPPSHNPAVPV
NATRESPSTDSLFSIPYYVYCCILGLLSCSLFLHMNFELKLLMLTLCLVIYNVLFLHSHA
WLSDCYVGRLYPNQTVLRELLGRPGVLKEPKLMGAVSFFVFFFTLLALARQNEYYCRLDF
LWKKKFKKEREEIETMENLNRVLLENVLPADVAQQFIGQNRRNEDLYHQSYDCVCVLFAS
IPDFKEFYSESNVNHEGLECLRLLNEIIADFDELLSKPKFSGVEKIKTIGSTYMAATGLN
ATSGQDNQQDAERSYTHLGIMVEFAVALIAKLDIINKHSFNTFKLRVGINHGPVVAGVIG
AQKPQYDIWGNTVNVASRMESTGVLGKIQVTEETARALETLGYTCYLRGVIKVKGKGQLR
TYYVCTDLSRSGLQAPMLS
NT seq 2940 nt   +upstreamnt  +downstreamnt
atgggctacatctttgtattcaccagcggcgtggtcagtgcctgggaccaggtctcattc
ttcctcttcatcatctttaccgtctacaccatgctgcccgtgtgcatgcgggatgccgtg
gtcgctggcctcgcctcctccctctcccacatcattgttttgggtgtctacctgtcagct
gggcgggggtcgcgggctgagctggctgtgcagctgctggccaacgctgtgatcttcatc
tgtggcaacctggtgggggcctatcacaagcacctgatggaggtggctttacaggagacc
ttccaggagaccttcaaactcatccagtcccgagtcaagctggagtctgagaaacggcac
caggagcacctccttctctccatcctacccgcgtacatcgccatggagatgaaggccgag
atcatcgagcggctgcgggacggagggcggcaggaaagcgcaaacaacttccacaacctc
tacgtcaagcaccacaagaacgtcagtatcctgtatgccgacatcgtggggttcacaaga
ctggccagcgagtgctccccaaaagagctggtcctgatgctcaacgaacttttcggcaag
tttgaccaaatcgccaaggacaatgagtgcatgcgcatcaagatcttgggtgactgctac
tactgcgtctcggggctgccggtctcactccccaaccacgcacgcaactgcgtcaagatg
ggattggatatgtgccaggctatcaagaagctacgggatgccaccggtgtggacatcaac
atgcgggtcggggtgcactcggggaacgtgctgtgcggggtcatagggctccagaagtgg
cagtatgatgtctggtctcacgatgtgacactggctaaccacatggaggctggaggagtg
ccagggagggtgcatataaccgaggccaccttgtctcacctgggaggggtctatgctgtg
gaggaaacctgtcgctggcagcgtgaccccttcctgaaggagaacaaagtaaagactttc
ctggtcattgacccttgggtgggagcggaaagctgcaacaacaccctgtccccggtgccc
ggggagggccagaagatgagggcgtctgtccgtatgacccgctacctggagtcctggggg
gctgccaagccctttgccaacctcaagcacctcgatccccccccagccgatcagccagga
ttcaccaggaacaaccattcggagagctctctggggtccctgacccagtcgaagacagtg
gagcgggttcgttcccccaaggggccggatgaggagctcgatggggtagatgagaaattt
ttccaggtgttggaacagctcaactcccagaagcagtggaagaagtcggaggattttaac
cgcatcaccctgtacttcaaggagaaactcatggagaaagagtatcgactctcagctctg
cctgccttcaagtactacacggcctgcaccttcctggtcttcctctccaacttcctcatc
cagatgctggtggcccacaagaccccagctctaggaatctcctatggcatctccttcttc
ctcttcatcctcctccttttcacctgcttcgctgggaacctggcgaagtgcttccagaaa
ggccccaagatgctgtactgggtgccctccctctccacggccgtctgcacccagccctgg
ctccgggtcaccctgggcgtcaccaccatcctggtcgtcctcaccatggctatgttcaac
ttcttcttcatacccacgccctggtgtcctccaccatcccacaatcccgcggtgccggtg
aacgccacacgggaatctccctcaaccgattccttattcagcattccgtactacgtttac
tgttgcatcctgggactcctctcctgctccctcttcctccacatgaattttgaactcaag
ctcctgatgctgacgctttgcctggtgatctacaacgtcctctttctccacagccacgcc
tggctctccgactgctacgtcgggcgcctctaccccaaccagaccgtgctccgggagctg
ctggggcggccaggggtcctgaaggaacccaagctgatgggagccgtttccttctttgtc
ttcttcttcaccctgctggccctggctagacaaaacgagtattattgccgtcttgacttc
ttatggaagaagaagttcaagaaggagcgtgaggagatcgagaccatggagaacctgaac
cgtgtcctgctggagaatgtgctcccggccgacgtggcacagcaattcatcggccagaac
cggcgtaacgaggacctttaccatcaatcctatgactgtgtctgcgtcctcttcgcctcc
atccctgacttcaaggagttctattctgagtccaacgtcaaccatgaagggctggagtgc
ttgcggctgctcaacgagatcattgcagattttgatgagctgctctcgaagccaaaattt
agtggcgtggagaagatcaagaccattggcagcacctacatggcagctacgggattaaat
gccacttctggccaggacaaccagcaggatgccgagaggagctacacccatctgggcatc
atggtggagttcgcggtggccctcatagccaagctggatatcatcaataaacactccttc
aacaccttcaaactccgcgtgggtataaaccatggcccagtggtggctggtgtgattgga
gcccagaaaccccagtatgacatttggggaaacacagtgaatgtggcgagtcgcatggag
agcaccggagtgctggggaagatccaggtcacagaagagacagccagggccctggagacc
ctgggttacacctgctacctccgtggggttatcaaggtcaagggcaaaggccagctacgg
acctactacgtctgcaccgacctgtcccgctctggcctgcaggcccccatgctcagctga

DBGET integrated database retrieval system