KEGG   Chelonia mydas (green sea turtle): 102946796
Entry
102946796         CDS       T02989                                 

Gene name
DCK
Definition
(RefSeq) deoxycytidine kinase
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
cmy  Chelonia mydas (green sea turtle)
Pathway
cmy00230  Purine metabolism
cmy00240  Pyrimidine metabolism
cmy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cmy00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    102946796 (DCK)
   00240 Pyrimidine metabolism
    102946796 (DCK)
Enzymes [BR:cmy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     102946796 (DCK)
SSDB
Motif
Pfam: dNK Thymidylate_kin AAA_18 AAA_28 AAA_33 AAA_17 ASL_C
Other DBs
NCBI-GeneID: 102946796
NCBI-ProteinID: XP_007065968
Position
4
AA seq 256 aa
MATPPKRSRAQSGIKKIAIEGNIAAGKSTFVNILKQVTQEWEVVPEPVERWCNVQSCQED
YEELTTSQKSGGNVLQMMYEKPDRWSFTFQTYACLSRIRAQLKSLNGKIREVENPVVFFE
RSVYSDRYIFASNLYESDCMDETEWTIYQDWHEWMNKQFGQSLQLDGIIYLRATPEKCLN
RIYLRGRDEEQEIPIEYLEKLHYKHESWLQHRTLRTDFEYLEEVPILTLDVNEDFKGNKD
QYENMIEKVKKFLSTL
NT seq 771 nt   +upstreamnt  +downstreamnt
atggccaccccccccaagcgcagccgggcccagagcggcatcaagaagatcgccatagag
ggcaacatcgctgcaggaaaatcaacatttgtgaatattctcaaacaagttacccaggaa
tgggaagttgttcctgagcctgtagaaagatggtgcaatgttcaaagctgccaagaggat
tatgaggagctgacgacatcacagaagagtggagggaatgtgcttcagatgatgtatgag
aaaccggaccggtggtctttcaccttccagacgtatgcctgcctgagcagaatccgggct
cagctcaaatcccttaatgggaaaatcagggaggtggagaaccctgtggtcttctttgag
cgatctgtgtatagcgacaggtatatttttgcatctaacttatatgaatctgattgcatg
gatgaaaccgaatggacgatttaccaagattggcatgaatggatgaataagcagtttggt
caaagccttcaactagatggaatcatttatctcagagccactcctgagaaatgcttaaat
aggatttacttgcgtggaagagatgaagaacaagaaattcctattgaatatctggagaaa
cttcactacaaacatgaaagctggcttcagcatagaacattacgaacggattttgaatac
ttggaagaagtacccatcttaacactggatgttaatgaagatttcaaaggcaacaaagac
cagtatgaaaatatgattgaaaaggtcaagaaatttttgagcactttataa

DBGET integrated database retrieval system