KEGG   Chelonia mydas (green sea turtle): 102947016Help
Entry
102947016         CDS       T02989                                 

Gene name
KDM8
Definition
(RefSeq) lysine demethylase 8
  KO
K10277  lysine-specific demethylase 8 [EC:1.14.11.27]
Organism
cmy  Chelonia mydas (green sea turtle)
Brite
KEGG Orthology (KO) [BR:cmy00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cmy03036]
    102947016 (KDM8)
Enzymes [BR:cmy01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.27  [histone-H3]-lysine-36 demethylase
     102947016 (KDM8)
Chromosome and associated proteins [BR:cmy03036]
 Eukaryotic Type
  Histone modification proteins
   Histone demethylases
    102947016 (KDM8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cupin_8 Cupin_4 JmjC
Motif
Other DBs
NCBI-GeneID: 102947016
NCBI-ProteinID: XP_007063740
Position
Un
AA seq 428 aa AA seqDB search
MSRPSSPEGRARSSSPAADQVSAGNALWADVRALLPSAKKDLKLDFSEKVEESVISLLQQ
ARDLLYGPGSLCSGGTRETCLQVSEIIIDYSWEKLNIGTWRDVDKDWRRVYSYGCLFKVL
CMCSEQGTIADTIRVCDMGLLMGASILDNILVRIINVLQKHLTYGKRSAEEDTKDSRRKK
IRNDRTTVPSVKSEEVIPRLHCPSLEHFRENYMIPQKPVILEGTVDHWPCMKKWSLDYLR
QIAGCRTVPVEVGSRYTDEEWSQTLMIVNDFIDQYIVNKNSIGYLAQHQLFDQIPELKQD
ICIPDYCSLGEGEEDDITINAWFGPEGTISPLHQDPQQNLLVQVIGRKYIRLYSPQESEN
LYPHETQILHNTSQVDVEDPDLVKFPKFERAAFQACILTPGQVLFIPVKYWHYVRSLDVS
FSVSFWWS
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgacccagctcccctgagggccgagccaggagctccagccccgctgcagatcag
gtctcagcagggaacgccctgtgggcagacgtcagggcattgctgcccagcgctaagaaa
gacctgaaactggacttcagcgagaaagtggaggaaagtgtcatctcactgctccagcaa
gctagagacctcctctatggacctggaagcctctgctctggaggcacaagggaaacctgc
ttacaagtcagtgaaataataatagattactcttgggaaaagcttaatattgggacttgg
agagatgtggacaaggactggcgacgagtctattcttatggctgccttttcaaagtgctg
tgtatgtgcagtgagcaaggcaccatagcagataccattcgggtctgtgacatgggactg
ctgatgggagcatccatattggataacatcctggttaggataattaatgtccttcagaag
catctaacatatgggaaacggtctgctgaagaagacacaaaggactcacgtagaaagaaa
atccggaatgaccgcactaccgttccatcagtaaaatcagaagaagttattccacggctt
cactgcccttctctagagcatttcagagaaaattatatgattccacaaaagcctgtcatc
ctggagggtactgttgaccactggccatgtatgaagaaatggagtctggattatctccgt
caaatcgccggctgccgcacagtccctgtagaagtgggttcccggtataccgatgaggaa
tggtctcagacactcatgattgtcaatgacttcattgatcaatatatcgtgaacaagaat
agcattggataccttgcccagcatcagctttttgatcagatcccagaactgaagcaggat
atttgcatccctgattactgcagcctgggggaaggggaagaagatgacatcaccattaat
gcttggtttggcccagagggaaccatctcacctcttcatcaagatccacagcaaaattta
ttagtccaggtaattggaagaaaatacatccgtctgtactctccacaggaatcagaaaat
ctatatccacatgaaacccaaattcttcacaacaccagccaggtggatgtggaggatccc
gatttagttaagttccccaagtttgaacgggctgcatttcaagcttgtattctgacacca
ggacaggttctgtttattccagttaaatactggcattatgtacgatctctcgatgtcagc
ttctctgtcagtttctggtggtcataa

DBGET integrated database retrieval system