KEGG   Chelonia mydas (green sea turtle): 102947040Help
Entry
102947040         CDS       T02989                                 

Gene name
TGFBR2
Definition
(RefSeq) transforming growth factor beta receptor 2
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
cmy  Chelonia mydas (green sea turtle)
Pathway
cmy04010  MAPK signaling pathway
cmy04060  Cytokine-cytokine receptor interaction
cmy04068  FoxO signaling pathway
cmy04144  Endocytosis
cmy04218  Cellular senescence
cmy04350  TGF-beta signaling pathway
cmy04520  Adherens junction
cmy04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:cmy00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102947040 (TGFBR2)
   04350 TGF-beta signaling pathway
    102947040 (TGFBR2)
   04068 FoxO signaling pathway
    102947040 (TGFBR2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102947040 (TGFBR2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102947040 (TGFBR2)
  09143 Cell growth and death
   04218 Cellular senescence
    102947040 (TGFBR2)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    102947040 (TGFBR2)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102947040 (TGFBR2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cmy01001]
    102947040 (TGFBR2)
Enzymes [BR:cmy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     102947040 (TGFBR2)
Protein kinases [BR:cmy01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   102947040 (TGFBR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ecTbetaR2 Pkinase_Tyr Pkinase Pkinase_fungal APH Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 102947040
NCBI-ProteinID: XP_007068565
Position
Un
AA seq 581 aa AA seqDB search
MIRFSFPEQESNLAAAFGTPWSLESRDFRRPQEEGISRIPECWDMIKADGILPVEQMKEN
RYKMHALCKFCDVEVTTCTQQGHCNSNCNRTSICEKENEVCVAVWRQNDANTTLETICHD
PALPVSEHKLEDPGSKTCVMKEKKAAGGLLFMCSCKEEECNDEIIFSEEESGSVPDILGV
MLKSLIPLLVITIAVNIIFYGYRIHRRRKLNKAWEKNVKPRKHKDCSDACAIMIDDDRSD
ISSTCANNINHNTELLPIELDTLVGKGRFAEVYKAKLKQNTSEQFETVAVKIFPYEEYAS
WKTEKDIFSDINLKHENILQFLTAEERKTELGKQYWLITAFHARGNLQEYLTRHIISWED
LWKLGGSLARGIAHLHSDHTPCGRPKTPIVHRDLKSSNILVKNDLTCCLCDFGLSLRLDP
TLSVDDLANSGQVGTARYMAPEVLESRMNLDNIESFKQTDVYSMALVLWEMTSRCNGVGE
VKDYEPPFGSKVREHPCVESMKDNVLRDRGRPEIPSSWLNHQGIQMVCETLIECWDHDPE
ARLTAQCVAERFNELEHQDRLSGRSCSEEKIPEDCSVTTTK
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atgatacggttctctttcccagaacaagaaagtaatttggctgcagcatttgggactccc
tggagcctagagagtagagatttcaggaggccacaggaagagggaatttccagaattcca
gaatgctgggacatgatcaaagctgatggtatcttgcctgtggaacaaatgaaggaaaat
agatacaaaatgcatgctctgtgtaaattctgtgatgtggaggtgacaacctgcacacag
caaggtcactgcaatagcaactgcaaccgcacttccatctgtgagaaggagaatgaagtc
tgtgtagcagtatggagacagaatgatgcaaacacaactttagaaacaatatgtcatgat
cctgctctgccagtctctgaacataaattggaggaccctggctcaaaaacctgtgttatg
aaagagaagaaggcagctggtggactgctgttcatgtgctcctgtaaagaggaagaatgc
aatgatgagatcatcttttcagaagaagagtcaggttcagttcctgatatacttggtgtg
atgcttaaaagtctcatcccattactcgtgatcaccattgctgtgaacattatcttttac
ggctaccgtattcataggagaaggaagctcaacaaggcatgggagaagaatgtaaagccc
aggaaacataaggactgcagtgatgcttgtgccattatgatagatgacgaccgctcagac
atcagctccacctgtgccaacaacatcaaccacaacaccgaactgctgcccatcgagcta
gacaccctcgtgggcaaaggcagatttgctgaagtgtacaaggccaagctgaagcaaaac
acatctgagcagtttgaaactgtggctgtcaagatcttcccttatgaagagtatgcctcc
tggaagacggagaaagacattttttcagatataaacctcaagcatgagaacatcctccag
ttcctgacagcagaagagcgtaagacagagctagggaaacaatactggttgatcaccgcc
ttccatgctagggggaacttgcaggaatatctcacacgacacatcatcagctgggaagac
ctatggaagctaggtgggtctttggcccgagggattgcccacctgcatagtgaccacacg
ccttgtggtcgacccaaaacgcccattgtgcacagagacctaaagagctccaatatccta
gtgaaaaatgatctaacctgctgcctctgtgactttgggttatctctgaggcttgatcct
actctgtctgtggacgatctggctaacagtgggcaggttggcacagcgagatacatggcc
cctgaagttctggaatccaggatgaatttggacaacatcgaatccttcaagcaaacggat
gtgtattctatggctttggtcctgtgggaaatgacttctcgctgtaatggtgttggagaa
gtgaaagactacgagcccccatttggttctaaagtacgagagcacccttgtgtagaaagc
atgaaggacaatgtcttgcgagatagagggcgtccagagatccctagctcctggctcaac
catcagggtatccagatggtgtgtgagactcttattgagtgttgggatcacgaccctgaa
gcccgactcactgcgcagtgcgtggctgagcgtttcaatgagcttgagcaccaggacaga
ctctcaggaagaagttgttcagaggagaaaatcccagaagactgctctgtgaccaccacc
aagtag

DBGET integrated database retrieval system