KEGG   Chelonia mydas (green sea turtle): 102947469Help
Entry
102947469         CDS       T02989                                 

Gene name
DOCK8
Definition
(RefSeq) dedicator of cytokinesis 8
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
cmy  Chelonia mydas (green sea turtle)
Brite
KEGG Orthology (KO) [BR:cmy00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cmy04131]
    102947469 (DOCK8)
Membrane trafficking [BR:cmy04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    102947469 (DOCK8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHR-2 DOCK-C2 DUF3398 DOCK_N GPR15L Cathelicidins
Motif
Other DBs
NCBI-GeneID: 102947469
NCBI-ProteinID: XP_007065638
Position
Un
AA seq 2038 aa AA seqDB search
MTQLNNLDSETVQELGDFPEDDLDIVFTPKECRTLQPSLPEEGVELDPHVRDCVQTYIRE
WLIVNRKNQGNSETCTFKKKGSRKDFHKTLQKQTFESETLDCNDASYQADPRPLNVLCDE
TGRTTLTSCDFNPRTLQPDPRLENLLQHISVEDFERQNEEARRANRHAELFALYPATDEE
DAVEIRPVPDCPKEHLGNRILVKLQTLKFDIEIEPLFACIALYDVKERKKISENFHCDLN
SEQFKGFLRSHTLCIDSSSQARSAVFSITYPSSDIYLVVKIEKVLQQGEIGDCAEPYMVL
KESEGGKSKEKVEKLKAQAESFCQRLGKYRMPFAWAPISLTNFFNFSTLEREMSEAESLN
GKGTTGDRRTMMLQGRRLSERSLNSEDSYAVSNFKATTLTVNTFIKQEGDRLSDEDLFKF
LTDYKRSSSLQRRVKSIPGLLKLEISPASEVLSCCLTPELLQVKPFPENRSRPQKEILEF
PVREVYVPHTVYRNLLYVYPQRLNFANRLASGRNITIKIQFMCGEDATCAMPIIFGKSSG
PEFLQEMYTAITYHNKSPDFYEEVKIKLPAKLTEKHHLLFTFYHISCQPKQGACVETLLG
YSWLPILLNDRLQTGHYCLPVALDKLPLNYSMHSPEKVPSQSPPIKWVEGHKGVFNVEVQ
AVSSIHTQDNHLEKFFTLCHSLESQVTFPIRVMDQKITEAALEHELKLSIICLNSSRLEP
LVLFLHLVLEKLFQLAVQPMVIAGQTANFSQFAFESVVAIVNSLHNSKDLSKDQHGRNCL
LASYVYYVFRLPEPQRDIARLGAAGSASLPESRYYTFGRTTAVSVGSRLLQSRVMSCSNP
DIPGTQTATDEEVKNIMSSKVADRTSSRMSFYIEATNDTSNASVSPRPSNKKHFHEELAL
QMVVSTGMVRETVFKYAWFFFELLIKSMAQYVHNIEKQHTPRRSRFSDRFKDDITTIVNV
VTSEIAALLVKAQKETEHAEKINISLAFFLYDLLSLMDRGFVFNLIRHYCNQLSNKLNTL
PTLISMRLEFLGILCSHEHYLNLNLFFMTSVSAPASPSPSLSSQNSSSCSSFQDQKIASM
FDLSADYRQQHFLAGLLFTELAAALDTEAEGISKVQRKAISAVHSLLSSHDLDQRCLKPE
VKVKIAALYLPLVGIILDALPQLYDFTVSEARSGKSRTGSPEEEQESTNPINQSVAWAIA
GNQFNLLRTSSAPLSSLPYKQYNTLSPDTTRNLLICFLWIMKNAEQSLIRKWIADLPSMQ
LNRILDLLFICVSCFEYKGKQSSDKVSTQVLQKSRDVKARLEEALLRGEGARGEMMKRCR
TPAGNDRFPGLNENLRWRKEQTQWRQANERLDKTKAELDQEALISGNLATEANLIILDMQ
ENIIQASSAVDCKDNLLGGVLKVLVNSLSCDQSTTYLTHCFATLRALIAKFGDLLFEEEM
EQCADLCQRVLHHCSSSIDITRIQACATLYLLMRHSFSSISNFARVKMQVTMSLASLVGK
SSDFNEEYLRRSLRTILAYAEEDMDMQPTLFPGQVKELLHNLNSILSDTVKMREFQEDPE
MLMDLMYRIAKGYQTSPDLRLTWLQNMAEKHAKKKCYTEAAMCLVHAAALVAEYLSMLED
HKYLPVGSVSFQNISSNVLEESAVSDDILSPDEDGICSGRYFSESGLVGLLEQAAELFST
GGLYETVNEVYKIVIPILEAHRDFRKLTSTHSKLQKAFDSIINKGQKRMFGTYFRVGFYG
SKFGDLDEQEFVYKEPAITKLPEISHRLEGFYGQCFGEDAVEVIKDSTPVDKSKLHPNKA
YIQITFVEPYFDEYEMKDRVTYFEKNFSLRRFMYTTPFTMDGRPRGDLSEQYKRNTILTT
MHAFPYVKTRINVIQKEEFILTPIEVAIEDMQKKTLELAVATNQEPPDAKMLQMVLQGSV
GATVNQGPLEVAQVFLAEIPADPKLYRHHNKLRLCFKEFIMRCGEAVEKNKRLITADQRE
YQLELRKNYSKLKENLRPMIERKIPELYKPIVKVHSTTRDSFRNSSFKKYEANSSQNI
NT seq 6117 nt NT seq  +upstreamnt  +downstreamnt
atgacacagctgaacaacttagactcagaaactgtgcaagaacttggtgactttcctgaa
gatgatttggacattgtctttactccaaaagaatgcaggactttgcagccttccttgcct
gaagaaggtgttgaattggatccacatgtcagggattgtgttcagacatatattcgggag
tggctaattgtgaatcgaaaaaaccaaggaaattcagaaacttgcacctttaaaaaaaag
ggatctcgaaaggattttcataagactcttcaaaaacaaacgttcgaatcggaaacattg
gattgcaatgatgccagctatcaggcagatcccaggcccttaaatgtactctgtgatgag
accggacgaaccaccctgacatcgtgtgactttaatcctcgcaccctgcagcccgatcca
cggctggaaaatctgctgcagcatattagtgtggaggactttgaaaggcagaacgaagaa
gcacggcgagccaataggcatgccgagctctttgccctctacccagccacggacgaggag
gatgcagtggagatacgaccagttccagactgcccaaaggaacatctgggcaacaggatt
ttggtgaagttgcagacactgaaatttgatatagaaatagaaccattgtttgcatgcata
gccctctatgatgtaaaagaaaggaaaaagatctctgaaaattttcattgtgacctgaat
tcagaacagttcaaaggattcttacgatctcacaccctctgcattgactcatctagtcag
gcaagatctgcagtattttctatcacttacccgtcttctgatatctacctagtagtaaag
attgaaaaagtcctccagcaaggagaaattggagactgtgccgaaccctacatggttcta
aaagaaagtgagggtggaaagagcaaagaaaaggttgagaaactgaaagcccaagctgag
tccttctgtcagcgtttggggaaatatcggatgcctttcgcctgggctcccataagctta
accaatttctttaacttttcaacgcttgaaagagaaatgtctgaagcagaaagtttaaat
gggaaaggaactactggtgacagaagaacgatgatgctccaaggtagaagactttctgag
aggagcctcaattcagaggacagttatgctgtgtcaaacttcaaagcgaccactctgact
gtcaacacctttataaaacaggaaggagaccgacttagtgacgaagacctattcaaattt
ttaacagactacaagagatcttcttccttgcagagaagagtgaagtccatcccaggatta
cttaaattggagatctccccagcttcagaagtcctcagttgctgtctcacccctgagtta
ttacaagtgaaaccatttcctgaaaaccgcagccgtcctcagaaagagattttggagttc
ccagttcgagaagtatatgttccccacactgtttatagaaatctcctttatgtttaccca
cagaggttgaattttgctaatcgactggcctctggaaggaacattaccattaagattcag
tttatgtgtggagaagatgctacctgtgcaatgccgatcatttttggaaaatcttcaggt
ccagaatttttgcaagagatgtacacagctatcacatatcataacaagtctcctgacttt
tatgaagaagtgaaaattaaactgccagctaaactcacagaaaaacaccacctactgttc
acattctaccatatcagctgtcagccaaagcaaggagcatgtgtagaaaccctcctggga
tattcatggctgccaattctattaaatgatcgtctccagactggacattattgtcttcct
gttgccttggataagttgcctttaaactattcaatgcattctccagagaaagttccatca
cagtcacctccaattaaatgggtcgaagggcacaagggggtgtttaacgtagaagtgcag
gctgtttcatctattcacactcaggacaaccacctggagaaattcttcactctgtgtcat
tctctggaaagtcaagtcaccttcccaattcgtgtgatggatcagaagatcacagaggct
gccctggaacacgagttgaaactcagcattatttgcttgaattcctcccgccttgagccc
ctggtcttatttttacacttggtgctggagaaacttttccagctggctgtgcagcccatg
gttatagctggtcagacagccaatttctcccagtttgcctttgaatctgtggttgcaata
gtgaacagtcttcacaacagtaaagacctgagcaaggaccagcatgggaggaactgtctc
ttggcatcatacgtctactacgtgtttcgccttccagagcctcaaagagatattgccaga
ctaggtgcagcaggaagtgccagtttgccagagtctcgttattacacatttggacgcacc
acagctgtgtctgttgggtccagacttctccagagccgggtaatgagctgcagcaatcca
gatattcctggtacacagactgctactgatgaggaagtcaaaaacatcatgtcatcgaag
gttgcagatcgcacctccagtcggatgtctttctatattgaagccaccaacgacacatca
aacgcgtctgtaagcccaagaccatccaataaaaagcatttccatgaagagctagcactg
cagatggtggtcagcactggcatggtgagagaaactgtcttcaagtatgcctggttcttt
tttgagcttctgataaagagcatggctcaatatgttcacaacattgaaaagcaacatact
ccacgaagaagtcgattttcagatcgtttcaaagatgacatcaccactatcgtcaacgtg
gtcacctcggagattgcagcacttttagttaaagcacagaaggaaactgaacacgcagaa
aagatcaacattagcttggcatttttcctgtacgatctgctttctctaatggaccgtgga
tttgtgtttaacctcatcagacattactgtaatcagctgtcaaacaagctcaataccctc
cccaccctaatttctatgaggctggagttcctagggattctctgcagccatgaacattac
ctcaatctgaatctcttcttcatgacttcagtgtctgcaccagcgtccccctctccctct
ctgtcatcacagaattcaagctcctgctctagtttccaggatcagaaaattgccagcatg
tttgacctttcggcagattatcgtcagcagcactttctggctggactgcttttcactgaa
ctggcagccgcactggacacggaggcagaaggaatcagtaaagtgcagaggaaagcgatc
agtgctgtgcacagcctgctgagttcccatgacctcgaccagcgctgcttaaaaccagag
gtgaaggtcaaaattgctgccctttacctccctttggttgggatcattttggatgcactg
ccacagctgtatgactttacagtttcagaagcccgcagtgggaaaagtcgtacagggagt
cccgaggaagagcaagaatctacaaacccaatcaatcagtctgttgcctgggccattgcg
gggaatcagttcaacctcctaaggacttcaagtgcacctctgtcttccctgccctacaaa
cagtacaacacattaagtcctgatactactcgcaaccttttgatctgtttcctctggatc
atgaaaaatgctgaacagagtctaattcggaagtggattgcagatcttccatccatgcag
ctgaacagaattttagatcttcttttcatttgcgtttcatgctttgagtacaagggtaaa
caaagctctgacaaagtcagcacccaagtgcttcagaaatcaagagatgtaaaagccagg
ctagaagaggctttactgagaggcgaaggagccaggggtgaaatgatgaaacgctgcagg
acaccagctgggaatgacagattcccagggttaaatgaaaacctgcgttggaggaaagag
cagactcaatggcggcaggcaaacgagaggctagataaaacaaaagctgagctagatcaa
gaagctctgatcagtggaaacctggctacagaagctaatttgatcatcctagatatgcag
gagaatatcatccaggcgagctcggctgtagactgcaaagataaccttttgggaggtgtg
ctgaaggtcctggtaaattctctcagctgtgatcagagcaccacatacctgactcattgc
tttgccacactcagagctctcattgccaagtttggagacttgctgtttgaagaggagatg
gagcagtgtgctgacctatgtcaaagagttctccatcactgcagcagcagcatagacatc
acacgaattcaagcctgtgctaccctttacctcctcatgagacacagtttcagctccatc
agtaattttgcaagagtgaagatgcaggtgacaatgtccctggcctctctggttggtaaa
tcatctgatttcaatgaggagtacctcagaagatccttacgaacgatcttggcgtatgca
gaagaagatatggacatgcagccaaccctgtttccaggccaggtgaaggagctgctacat
aatctgaacagtatcttgtcagacacagtgaaaatgagggagtttcaggaagatccagag
atgctcatggatctcatgtacagaattgccaaagggtatcagacatcacctgacttgagg
ctgacttggctacagaacatggcagagaaacacgccaagaagaagtgttacactgaggca
gccatgtgcctggtccatgctgctgctctggttgcagaatacctgagcatgctagaggat
cacaagtacctgccagtgggcagcgtcagctttcagaatatttcctccaatgtgctggag
gaatctgctgtttcggatgatattttgtctccagatgaggatgggatctgttctgggagg
tatttctctgagagcggcctggtggggctgctggaacaagctgcagagctcttcagcacg
gggggattgtatgaaactgtgaatgaggtctacaaaattgtcatccccatactggaagca
catcgagacttcaggaagcttacctctacgcacagcaagcttcaaaaagccttcgacagc
attattaacaagggtcaaaagcgaatgtttggaacttacttccgtgttggtttctatgga
tccaaatttggggacttagatgaacaggaatttgtttataaagagcctgcaattactaaa
cttcctgagatttctcacagacttgaggggttttatggtcagtgctttggggaggatgct
gtggaggttattaaagactccactcctgtagacaaaagcaagctgcatcccaataaggcc
tacatacaaattacatttgtggagccctatttcgatgagtatgagatgaaagacagggtg
acctactttgagaagaacttcagcctccggcgtttcatgtacaccacccctttcaccatg
gatggacgccccaggggggatctgagtgaacagtacaagaggaatactatcctgaccaca
atgcatgccttcccctatgtcaaaaccagaatcaacgtcattcaaaaggaggagttcatt
ttaaccccaattgaagttgctattgaagacatgcagaagaagacactagaactggctgtt
gcaacgaaccaggagccaccagatgccaaaatgctccagatggtgctgcagggttctgtt
ggagccactgtaaatcagggaccactagaggtagcccaagtgttcctggcggaaattcca
gcagacccaaaactttaccgacatcacaacaagctgaggttatgcttcaaagaatttata
atgagatgtggtgaagcagtggagaaaaacaagcgccttattactgcagatcagcgggag
tatcagctggaactcagaaagaactatagcaagctgaaagagaaccttaggccgatgatt
gagcggaaaatcccagagctgtataaacctatagtgaaagtccacagtacaacaagggat
tcttttcgtaactctagttttaagaaatacgaagccaattcttcacagaatatctaa

DBGET integrated database retrieval system