KEGG   Chelonia mydas (green sea turtle): 102947618Help
Entry
102947618         CDS       T02989                                 

Gene name
LTB4R
Definition
(RefSeq) leukotriene B4 receptor
  KO
K04296  leukotriene B4 receptor 1
Organism
cmy  Chelonia mydas (green sea turtle)
Pathway
cmy04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:cmy00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    102947618 (LTB4R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:cmy04030]
    102947618 (LTB4R)
G protein-coupled receptors [BR:cmy04030]
 Rhodopsin family
  Lipid
   Leukotriene
    102947618 (LTB4R)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srx 7tm_4
Motif
Other DBs
NCBI-GeneID: 102947618
NCBI-ProteinID: XP_007069377
UniProt: M7BF37
Position
Un
AA seq 348 aa AA seqDB search
MTNVTFNATAQPGALPPLPGAKLGLTVLSLAFILGFPGNIFVVWSALWRVQKRTVTCLLI
LHLALADCAVLLTSPFFLRLLSAGKWEFGPVVCQLCHYVCGVSMYASIFLITLMSLDRCL
AVTKPFISQKIRTALVVRSLVLAIWMVSFLLALPVIFYRKLVHRGRHLLCDLSHPATGHL
VFHNLFETLTGFVLPFTAIIWSYCVIGRRLQETRFRRKRRTNRLIVLIVAAFALFWLPFH
VVNILDVAGALSHSKGLIMAGKLARPTLTALAFFSSSVNPILYTFTGGALIKSAGIGFMA
KLFEGTASEMSSTRQGTGRTIQRREEAKLEMPQDGNPESITVSTNPLE
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgaccaacgtcaccttcaacgccactgcccagccaggtgcgctgcccccgttgcccggc
gccaagctggggctgaccgtgctctccttggccttcatcctgggcttcccgggcaacatc
ttcgtggtgtggagtgctctctggcgtgtccagaagcgcacagtcacctgcctcctcatt
ctccacctggccttggccgactgcgccgtgctgctcacttcccctttcttccttcggctc
ctgagcgccggaaagtgggagttcggccctgtggtctgccagctgtgccactatgtctgc
ggcgtcagcatgtacgccagcatcttcctcatcaccctcatgagtctggaccgctgctta
gctgtcaccaagcccttcatctcccagaagatccggaccgccctggtggtcaggtccttg
gtcctggccatctggatggtctctttcctccttgccttgcccgtcattttctaccgcaag
ctggtgcacaggggcaggcacctgctctgcgacctgtcccatcccgccactggccacctt
gtcttccacaacctttttgagaccctgaccggctttgtgctgcccttcactgccatcatc
tggagctactgcgtcatcgggcgcaggctgcaggagacccgcttccggaggaagcgccgc
accaaccggctcattgtgctgattgtggctgccttcgccctcttctggctacccttccac
gtggtgaacatcctagacgtggctggggctctgagccactccaagggtctcatcatggct
gggaagttggcccggcccaccctgacggccctggctttcttcagcagcagcgtcaacccc
atcctctataccttcaccggcggtgccttgattaagtcggccggcataggcttcatggcc
aagctctttgaggggacggcctcagagatgtccagcacgcggcaggggacggggcggacc
atccagcggcgcgaggaggccaagttggagatgccgcaggatgggaacccagagagcatc
accgtttccaccaaccccctggagtag

DBGET integrated database retrieval system