KEGG   Chelonia mydas (green sea turtle): 102947735Help
Entry
102947735         CDS       T02989                                 

Definition
(RefSeq) cytosolic phospholipase A2 epsilon-like
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
cmy  Chelonia mydas (green sea turtle)
Pathway
cmy00564  Glycerophospholipid metabolism
cmy00565  Ether lipid metabolism
cmy00590  Arachidonic acid metabolism
cmy00591  Linoleic acid metabolism
cmy00592  alpha-Linolenic acid metabolism
cmy01100  Metabolic pathways
cmy04010  MAPK signaling pathway
cmy04217  Necroptosis
cmy04270  Vascular smooth muscle contraction
cmy04370  VEGF signaling pathway
cmy04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:cmy00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    102947735
   00565 Ether lipid metabolism
    102947735
   00590 Arachidonic acid metabolism
    102947735
   00591 Linoleic acid metabolism
    102947735
   00592 alpha-Linolenic acid metabolism
    102947735
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102947735
   04370 VEGF signaling pathway
    102947735
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    102947735
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    102947735
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    102947735
Enzymes [BR:cmy01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     102947735
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B cPLA2_C2 C2
Motif
Other DBs
NCBI-GeneID: 102947735
NCBI-ProteinID: XP_007055829
Position
Un
AA seq 821 aa AA seqDB search
MGSSTSSYQQMEPSPCNLLSVKVIRMKNLRKADLLTQSDCYVSLWLPTASVKKARTKTVK
NSKNPVWNETFHFRIQSQVKNILELKVCDEDEHTPDDHLLTVFFDVSKIQLGETVRLNFL
VNPQGKEELEVEFTMESSPDLPENIATNGVLVSREVSCLEVQVDEGRIKKESTERKFAFT
VEGSYEGTQNLSLSSYLCPASPARFHYIKYNHSELGIALPKMRQLSVSSSSQDESESLTL
ALNSLPIQDKVTIGETRTFDLHVKTKEWTQGLFNSSRKLDVRLGFDLCPEEQNFLKNRKK
LVAAALKKVLRLEEDLKDHEVPVVAVTTTGGGIRALTAMYGSILGLQKLNVLDCVSYITG
SSGTTWTMTNLYEDDDWSQKDLGELIIEARKQASKSKMSAFSLESLKNYHRELSQRTQAG
YKTSFIDLWGLMIESMLNDEKEEHKLSDQQQAVNWGQNPLPIYLALNVKDNITTKDFREW
VEFTPYEVGFLKYGAFIRAEDFGSEFFMGRLMKKLPESRICFMQGMWSSVFSKNLLDAWH
AADNSEDFWHRWTQDRVTEIEEEPDLPERPHEMATCMYTPAGGISNALRDILTDRPAVSK
YHSFLRGFQMHNEYTQHEQFSKWKDTMLDSLPNQLRHTAEHLELVDTAFFFDTSYPPLMR
PERKVDVILHLNYSGGSQTTPLDRASTYFSEQGIPFPKPVLNEEERKNLKECYMFEDAEN
PSAPILLYFPLVNDSFQRYIAPGVERSASEIELGKVDVSSFYSPYSTREVSLKAQDFNKL
LKLTNYNIQNNENLILQALHAAVRRRKQSQTQSPSQAQSSS
NT seq 2466 nt NT seq  +upstreamnt  +downstreamnt
atggggtcatctaccagttcgtaccagcagatggagccctctccttgcaacttgctcagt
gtaaaagttatcagaatgaaaaatctgcggaaggccgacctgctaacccagtctgattgc
tatgtgagcctatggctaccgactgcttcagtaaaaaaggcccggactaaaactgtcaag
aactccaaaaacccagtgtggaatgaaaccttccacttcaggattcagagtcaggtcaag
aatatcctggagctgaaagtctgtgatgaagatgaacacactccagatgaccatctcctc
actgtttttttcgatgtatctaaaatccaacttggagaaacagttcggctgaactttctg
gtgaatccacagggaaaggaagagctagaggttgaattcacaatggagagcagtccagat
cttcctgaaaacattgctaccaatggtgtattagtgtctcgtgaagtttcctgtttggaa
gttcaggtggatgaggggaggataaagaaggaatccacagaaagaaaattcgcatttaca
gtggaaggatcctatgaaggaacccagaacctttcactgagctcctacctttgtcctgct
tctcctgccagattccactatatcaagtataatcactcagagctgggcattgcactacca
aagatgagacagctctctgtgtcttcctcaagtcaagatgaaagtgagtccctgactcta
gctctgaattcacttcccattcaagataaagtaacaataggagagaccagaacgtttgat
ttgcatgtgaagacaaaagaatggactcagggcctgtttaacagctcaagaaaactagat
gtacgtttgggatttgacctgtgcccagaggaacagaattttctgaagaatcggaagaaa
ctggttgctgctgctctgaagaaggttcttcggctagaggaggatctgaaggaccatgag
gtgccagttgtggctgtgacaacaacaggaggtgggataagagctttgacagccatgtat
ggcagcattttgggtcttcagaaactgaatgttctcgactgtgtttcatacatcactggc
tcatctgggacaacatggaccatgacaaacttgtatgaagatgatgattggtcacagaag
gatctaggggagctaatcattgaagctcggaagcaagcatccaaatccaaaatgagtgct
ttttccttggaaagtttgaagaattatcacagggagctgagtcaacgcacccaagcagga
tacaagacatcttttatagatctctgggggctcatgattgaatccatgttgaatgatgag
aaagaggagcataaactctcagatcagcaacaggcagtgaattggggtcagaacccactg
cccatctacctggctctcaatgtcaaggacaacattaccactaaagattttagagagtgg
gtggagttcactccctatgaggtgggattcctgaaatatggagcctttattcgtgcggag
gattttggaagtgagttcttcatgggccggctgatgaagaagctcccagaatctcggatc
tgcttcatgcaaggaatgtggagtagtgtattttccaagaatctcttggacgcatggcat
gcagctgacaattcagaggacttctggcatagatggacccaagacagagtgactgaaata
gaggaagagcctgatctacctgagaggccacatgagatggctacttgcatgtacactcct
gcaggaggcatttccaatgcacttcgagatattttaacggatcgcccagcggtatcaaag
taccacagtttcttaaggggtttccagatgcacaacgagtacacacagcatgagcagttt
tctaaatggaaagacactatgctagactctttgcctaatcaactgagacacactgcagag
catctggagctggtagatactgcattcttctttgataccagttacccaccacttatgaga
ccagagaggaaagtggacgtcatcctgcatttaaactacagtggaggatcacagacaacg
cctctggaccgggcctctacgtacttctcagagcaaggcatcccatttcctaagcctgtg
ttgaatgaggaagaaaggaagaatctaaaggagtgttatatgtttgaagatgcagagaac
ccaagtgctcccatactgctttatttccctctcgtgaatgacagcttccaaagatacata
gcacctggtgtggaacgcagtgcatcagaaatagaactgggcaaagttgatgtctccagt
ttctattccccatattctacaagggaggtctcactgaaggcacaagatttcaacaagctg
ctgaaactgactaattacaacatccagaataatgaaaacttgattcttcaggccttgcat
gcagcggtgaggaggagaaaacaatctcagacccagtccccatcccaagcacagtcatcc
tcctga

DBGET integrated database retrieval system