KEGG   Chelonia mydas (green sea turtle): 102948283Help
Entry
102948283         CDS       T02989                                 

Gene name
MAPKAPK2
Definition
(RefSeq) mitogen-activated protein kinase-activated protein kinase 2
  KO
K04443  mitogen-activated protein kinase-activated protein kinase 2 [EC:2.7.11.1]
Organism
cmy  Chelonia mydas (green sea turtle)
Pathway
cmy04010  MAPK signaling pathway
cmy04218  Cellular senescence
cmy04370  VEGF signaling pathway
cmy04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:cmy00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102948283 (MAPKAPK2)
   04370 VEGF signaling pathway
    102948283 (MAPKAPK2)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    102948283 (MAPKAPK2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    102948283 (MAPKAPK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cmy01001]
    102948283 (MAPKAPK2)
Enzymes [BR:cmy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     102948283 (MAPKAPK2)
Protein kinases [BR:cmy01001]
 Serine/threonine kinases: CAMK group
  MAPKAPK family [OT]
   102948283 (MAPKAPK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Kinase-like Pkinase_fungal Choline_kinase
Motif
Other DBs
NCBI-GeneID: 102948283
NCBI-ProteinID: XP_007065145
Position
Un
AA seq 307 aa AA seqDB search
MLQDCPKARREVELHWRASQCAHIVKIIDVYENLYQGKKCLLIVMECLDGGELFSRIQDR
GDQAFTEREASEIMKSIGEAIQYLHSINIAHRDVKPENLLYTSKRPNTVLKLTDFGFAKE
TTTHNSLATLCYTPYYVAPEVLGPEKYDKSCDMWSLGVIMYILLCGYPPFYSNHGLAISP
GMKKRIRMGQYEFPNPEWSEVSEEVKQLIRNLLKTDPTQRMTITEFMNHPWIMQSMQVPQ
TPLHTSRVLKEEKDLWEDVKEEMTSALATMRVDYEQIKIKKIEDSSNPLLMKRRKKANPS
EPTALPH
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgctgcaggactgccccaaagcccgcagggaagtcgaactccactggagggcatcgcag
tgtgcccacattgtaaagatcattgatgtctatgaaaacctgtaccaggggaagaagtgc
ctgcttatagtcatggagtgcttggatggtggggagctcttcagtcgaattcaagatagg
ggagaccaggccttcacggaacgggaggcttcagaaataatgaagagcatcggagaagcc
atccagtacttgcactcgattaacatagcgcaccgggatgttaagccagaaaacctcttg
tacacctcaaaaaggcccaacactgtactgaaactcaccgacttcggctttgctaaagaa
accaccacccacaactccctggccacactgtgctacacaccttactacgtggccccggag
gtgctgggccctgagaagtacgacaagtcctgtgacatgtggtccctgggcgtcatcatg
tacattttgctgtgtgggtatccccctttctattccaaccatggtctggccatttctcca
ggcatgaaaaaacggatccgaatgggccaatatgaatttcccaaccctgagtggtcagaa
gtgtccgaagaagttaaacagttgatccggaacctgctgaagacagatccgacccagcgc
atgacaataacggagttcatgaaccacccctggatcatgcaatcgatgcaggtgccccag
acgccgctgcacactagccgagtcttgaaagaagagaaagacttgtgggaggacgtcaag
gaggaaatgacgagtgccttggccaccatgagagtagattacgaacaaattaagataaag
aaaatcgaagactcctccaaccctttgctcatgaagagacgaaagaaagcgaacccctct
gagccgacagcactcccccactga

DBGET integrated database retrieval system