KEGG   Croceicoccus naphthovorans: AB433_05160Help
Entry
AB433_05160       CDS       T03964                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
cna  Croceicoccus naphthovorans
Pathway
cna00071  Fatty acid degradation
cna00072  Synthesis and degradation of ketone bodies
cna00280  Valine, leucine and isoleucine degradation
cna00310  Lysine degradation
cna00362  Benzoate degradation
cna00380  Tryptophan metabolism
cna00620  Pyruvate metabolism
cna00630  Glyoxylate and dicarboxylate metabolism
cna00640  Propanoate metabolism
cna00650  Butanoate metabolism
cna00900  Terpenoid backbone biosynthesis
cna01100  Metabolic pathways
cna01110  Biosynthesis of secondary metabolites
cna01120  Microbial metabolism in diverse environments
cna01130  Biosynthesis of antibiotics
cna01200  Carbon metabolism
cna01212  Fatty acid metabolism
cna02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AB433_05160
   00630 Glyoxylate and dicarboxylate metabolism
    AB433_05160
   00640 Propanoate metabolism
    AB433_05160
   00650 Butanoate metabolism
    AB433_05160
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AB433_05160
   00072 Synthesis and degradation of ketone bodies
    AB433_05160
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AB433_05160
   00310 Lysine degradation
    AB433_05160
   00380 Tryptophan metabolism
    AB433_05160
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AB433_05160
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AB433_05160
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AB433_05160
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cna04147]
    AB433_05160
Enzymes [BR:cna01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AB433_05160
Exosome [BR:cna04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AB433_05160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AKM09507
UniProt: A0A0G3XE83
Position
1020006..1021187
Genome map
AA seq 393 aa AA seqDB search
MSDPVVIASYARTPMGGLQGAFSEVGATHLGAEAVRAAVSRAGISGEAVDQIVMGCVLPG
GLGQAPARQAAIFADLGQHVEATTINKMCGSGMQAAIMAHDALLAGSAEVIVAGGMESMT
GAPYLLPKHRGGARLGHDVVKDSMFLDGLEDAYNPGKLMGAFAEEAAQEYQFTREVQDEY
AIRSLSLARKAQDEGGFDREITPVTVKTRKGEATVAIDEQPGKANVEKIPSLRPAFAKDG
TVTAANSSSISDGAAALVMCRASTAEKLGMTPVAKVVGHAFHAHEPARFTTAPVFATRKL
MERIGWSMDDVDLFEVNEAFAVVALIAERDLGIDRDKLNVNGGACALGHPIGASGARIMA
TLLGALETRKLKRGVASICIGGGEATAIALELI
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaccccgtcgtcattgccagctatgcccgcacgccgatgggcggattgcagggc
gctttttccgaagtcggtgcgacgcatttgggggccgaggcggttcgcgccgcggtttcg
cgcgccggaatttcgggcgaagcggttgatcagatcgtgatgggctgcgtcttgcccggc
ggattggggcaggcacctgcgcggcaggcggcgatctttgccgatctggggcagcatgtc
gaagcgacgacgatcaacaagatgtgcggatcgggcatgcaggccgcgatcatggcgcac
gatgcactgctggccggaagcgccgaggtaattgtcgcgggcgggatggagagcatgacc
ggcgcgccctatctgctgcccaagcatcgcggtggggcgcgactggggcacgatgtcgtc
aaggactcgatgttcctcgacggactggaagatgcttacaaccccggcaaactgatgggc
gcctttgcagaagaagcggctcaggaataccagttcacccgagaggtgcaggacgaatac
gcaatccgctcgctttctctggcgcgcaaggcgcaggacgagggcggcttcgatcgcgaa
attacgccggttacggtgaagactcgcaagggcgaagcaacggttgccatcgacgaacag
ccgggcaaggccaatgtcgagaaaatcccctcgctccgtcccgccttcgcaaaggacggc
acggtgacggcggcgaacagttcttcgatttctgacggcgcggcagcgttggtaatgtgt
cgtgcctcgacggcggagaagctgggcatgacgccggtggccaaggttgtcggccatgcc
tttcacgcgcacgaaccggcccggttcacgaccgcaccggtcttcgccacgcgaaaactg
atggagcggatcggctggtcgatggacgatgtcgacctattcgaagtgaacgaggcattc
gcggtcgtcgccctgattgccgaacgcgatctcggcatcgaccgcgacaagctgaacgtc
aacggtggggcctgcgcgctgggccatcccatcggtgcatcgggcgcgcggatcatggcg
accctgctgggcgcgctggagacccgcaagctgaagcgcggtgttgccagcatctgcatc
ggcgggggcgaggccactgcgatcgcgctcgaactgatttga

DBGET integrated database retrieval system