KEGG   Croceicoccus naphthovorans: AB433_05630Help
Entry
AB433_05630       CDS       T03964                                 

Definition
(GenBank) magnesium transporter ApaG
  KO
K06195  ApaG protein
Organism
cna  Croceicoccus naphthovorans
Brite
KEGG Orthology (KO) [BR:cna00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    AB433_05630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4352 Chitin_bind_4
Motif
Other DBs
NCBI-ProteinID: AKM11574
UniProt: A0A0G3XLS3
Position
1114787..1115185
Genome map
AA seq 132 aa AA seqDB search
MDQLFDHAASADGITVRVSVSYLPEQSQVPAGRWFWAYHIRIENKGDEAATLVSRHWRIT
DADGRVSIIDGEGVVGEQPRLAPGQSHDYVSGCPLTTPHGSMEGFYSFVRDDGTKFEAPI
PFFPLAAPATAR
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
atggaccagcttttcgaccatgccgcaagtgccgacgggatcacagtccgcgtttcggtc
agctatctgcccgaacaatcgcaagtgcccgcaggtcgctggttctgggcctatcacatc
cggatcgagaacaagggcgacgaagcggccacgctggtcagccgccactggcgcatcacc
gatgccgacgggcgcgtttccatcatcgatggagagggtgtggtgggcgaacagccgcgt
ctcgcccccggccaaagccacgactatgtctcgggctgtccgttgacgacgccgcacggt
tcgatggaggggttctacagcttcgtccgcgacgatggcacgaagttcgaggcgccgatc
ccgttctttccgctggcggccccggccaccgcgcgctga

DBGET integrated database retrieval system