KEGG   Croceicoccus naphthovorans: AB433_10405
Entry
AB433_10405       CDS       T03964                                 

Definition
(GenBank) hypothetical protein
  KO
K14584  2-hydroxychromene-2-carboxylate isomerase [EC:5.99.1.4]
Organism
cna  Croceicoccus naphthovorans
Pathway
cna00626  Naphthalene degradation
cna01100  Metabolic pathways
cna01120  Microbial metabolism in diverse environments
cna01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cna00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00626 Naphthalene degradation
    AB433_10405
Enzymes [BR:cna01000]
 5. Isomerases
  5.99  Other isomerases
   5.99.1  Sole sub-subclass for isomerases that do not belong in the other subclasses
    5.99.1.4  2-hydroxychromene-2-carboxylate isomerase
     AB433_10405
SSDB
Motif
Pfam: DSBA Thioredoxin_5
Other DBs
NCBI-ProteinID: AKM11745
UniProt: A0A0G3XJK9
Position
complement(2067252..2067833)
AA seq 193 aa
MIDFFFDFMSPFAYLAHSQLPELARKHGYELRYRPIDLPAAKLAAGNTGPPNVSMPIKLR
YLRKDLDRWAERYKIPISFPPSLKSELANKGVFFAEAKGQCKDYVRHVWSHSWGEGQDMS
SEELLAEIASELGWEPDAFLAYVHSEEAEDAYRLSNEEAHSRGVFGAPIMMIGEEMWWGS
DRLFFLDEYLSSQ
NT seq 582 nt   +upstreamnt  +downstreamnt
atgatcgatttctttttcgatttcatgagcccgtttgcctatctggcgcatagccaattg
ccggagcttgcgcgcaagcacggttatgaactgcgctatcgcccgatcgatctgcctgcg
gccaagttggctgcaggcaataccggtccgcccaatgtgtcgatgcctatcaagttgcgc
tatctgcgtaaggatctcgatcgctgggctgagcggtacaagatcccgatctcctttcct
ccatccctgaagtcggagctggccaataagggcgtgtttttcgccgaggccaaggggcag
tgcaaggattatgtccgccatgtttggtcccattcctggggtgaggggcaggacatgtcg
agcgaggagctgctggctgagattgcgagcgagctggggtgggagccagatgcctttctc
gcctatgttcactccgaagaagccgaagatgcctaccgattaagcaatgaagaagcgcat
tcgcgcggcgtattcggcgcgccgatcatgatgattggcgaggaaatgtggtgggggagc
gaccgattgttcttccttgatgaatatctatcgagccagtga

KEGG   Croceicoccus naphthovorans: AB433_18205
Entry
AB433_18205       CDS       T03964                                 

Definition
(GenBank) DSBA oxidoreductase
  KO
K14584  2-hydroxychromene-2-carboxylate isomerase [EC:5.99.1.4]
Organism
cna  Croceicoccus naphthovorans
Pathway
cna00626  Naphthalene degradation
cna01100  Metabolic pathways
cna01120  Microbial metabolism in diverse environments
cna01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cna00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00626 Naphthalene degradation
    AB433_18205
Enzymes [BR:cna01000]
 5. Isomerases
  5.99  Other isomerases
   5.99.1  Sole sub-subclass for isomerases that do not belong in the other subclasses
    5.99.1.4  2-hydroxychromene-2-carboxylate isomerase
     AB433_18205
SSDB
Motif
Pfam: DSBA Thioredoxin_4 Thioredoxin_5
Other DBs
NCBI-ProteinID: AKM12071
UniProt: A0A0G3XN71
Position
p1:115768..116355
AA seq 195 aa
MTRKIDFYFDFISPFSYLAQLKLPEIARKAGCELEYWPIDIPEAKIAAGNYGPSNREVVP
KIKVMMADLNRWARKYDAPLRFPASFACKDWNCATLYAREQGKAGAFVAAAYNRIWGQGI
DPSDREELRACAAEAGLDAEALTAFVDSSLGQNEYRKVRSQAYQRGVFGAPLMFVDDEIF
WGNDRLEFLEEYLEK
NT seq 588 nt   +upstreamnt  +downstreamnt
atgacccgcaagatcgacttctatttcgacttcatcagtcccttcagctacctcgcgcag
ctgaagctccctgaaatcgcccgcaaggccggttgcgaactcgaatattggccgatcgat
atccccgaggcgaagatcgcggcggggaactacggcccgtccaatcgcgaggtggttccg
aaaatcaaggtgatgatggcggacctcaaccggtgggcccgcaaatacgacgctcccttg
cgttttccggccagctttgcctgcaaggactggaactgcgccacgctctatgcgcgcgag
cagggcaaggcgggagcattcgtcgccgctgcttacaatcgcatctggggacaggggatc
gatccaagcgaccgcgaagaactgcgcgcctgcgcagccgaagccgggcttgatgcagaa
gcgttgactgccttcgtggactcgtcactaggccagaacgaataccggaaggttcgaagc
caagcctatcagcggggagtcttcggcgcgccattaatgtttgtcgacgatgaaatcttc
tggggcaacgaccgcctggagttcttggaagagtacttagaaaaatag

DBGET integrated database retrieval system