KEGG   Croceicoccus naphthovorans: AB433_10410
Entry
AB433_10410       CDS       T03964                                 

Definition
(GenBank) aldolase
  KO
K14585  trans-o-hydroxybenzylidenepyruvate hydratase-aldolase [EC:4.1.2.45]
Organism
cna  Croceicoccus naphthovorans
Pathway
cna00626  Naphthalene degradation
cna01100  Metabolic pathways
cna01120  Microbial metabolism in diverse environments
cna01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cna00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00626 Naphthalene degradation
    AB433_10410
Enzymes [BR:cna01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.45  trans-o-hydroxybenzylidenepyruvate hydratase-aldolase
     AB433_10410
SSDB
Motif
Pfam: DHDPS
Other DBs
NCBI-ProteinID: AKM10279
UniProt: A0A0G3XI44
Position
complement(2067862..2068842)
AA seq 326 aa
MAGHRVGVADVQGVWAIMPTPSKPNAEDPNARDTVDLDETTRVVKALIDSGANGILTLGS
LGEVATLTWDEKRDFMKALVEVAGGRVPVFGGTSTLSTRTTIDETRAARDIGVDGTMVGP
PMWCAPDVPTAVQFYRDLAEACPDMSICIYANPEAFKFEFPRPFWAQVSEIPQVVTAKYL
GIGALVPDLNLTKRRIRFLPIDVDYYAAAKIDPEFCTAFWSSGAVCGPNPVIALRDAVAQ
AKTSGDWSKAEELTGAMAQTYQTLFPQGSFKVFSSYNIPLEKARMDAAGWMKAGPCRPPY
NIVPEDYLEGGRESGRRWAKLHKSLA
NT seq 981 nt   +upstreamnt  +downstreamnt
atggctggtcatagagtaggggtggctgatgtgcagggggtgtgggccatcatgcccaca
ccgtccaagcccaacgcagaggaccctaatgcgcgcgatacggtggatctcgacgaaacc
acgcgggtcgtcaaagcgctgatcgactcaggggccaacggcatcctgacgctcggttcg
ctgggggaggtggccacgctgacctgggatgagaagcgcgatttcatgaaggcgcttgtc
gaggttgcaggcggcagggtgcctgtctttggggggacttcgaccctgtcgacgcgcacc
acaatcgatgaaacgcgcgcggcgcgcgatatcggggtcgatggcaccatggtcggtccg
ccgatgtggtgcgcgcccgatgttcccacggccgtgcagttctaccgcgatcttgcggaa
gcctgccccgacatgtcgatttgcatctacgcaaatccggaggccttcaaattcgaattc
ccgcgccccttttgggcgcaggtttccgagatcccgcaggttgtcactgcaaaatatctg
ggcattggcgcactggtgccggatctcaacctgacgaaaagacggatccgctttttgccg
atcgatgttgactactatgcggcggcgaagatcgatccggaattctgcacggccttctgg
tcgagcggcgcggtatgcggtcccaacccggtgatcgctttgcgtgatgcggtggcgcag
gccaagacgtcaggcgattggagcaaggccgaagagctgaccggcgcgatggcacagacc
tatcagacgctctttccgcagggctcgttcaaggtcttttcttcctataacatcccgctc
gaaaaggcgcggatggatgccgcaggatggatgaaggctggtccttgtcgtccgccctac
aacattgttcccgaggattatctcgaaggcgggcgcgagtccgggcggcgttgggcaaaa
cttcacaagagcttggcgtaa

DBGET integrated database retrieval system