KEGG   Croceicoccus naphthovorans: AB433_10675
Entry
AB433_10675       CDS       T03964                                 

Definition
(GenBank) S-(hydroxymethyl)glutathione dehydrogenase
  KO
K00121  S-(hydroxymethyl)glutathione dehydrogenase / alcohol dehydrogenase [EC:1.1.1.284 1.1.1.1]
Organism
cna  Croceicoccus naphthovorans
Pathway
cna00010  Glycolysis / Gluconeogenesis
cna00071  Fatty acid degradation
cna00350  Tyrosine metabolism
cna00620  Pyruvate metabolism
cna00625  Chloroalkane and chloroalkene degradation
cna00626  Naphthalene degradation
cna00680  Methane metabolism
cna01100  Metabolic pathways
cna01110  Biosynthesis of secondary metabolites
cna01120  Microbial metabolism in diverse environments
cna01200  Carbon metabolism
cna01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AB433_10675
   00620 Pyruvate metabolism
    AB433_10675
  09102 Energy metabolism
   00680 Methane metabolism
    AB433_10675
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AB433_10675
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    AB433_10675
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    AB433_10675
   00626 Naphthalene degradation
    AB433_10675
Enzymes [BR:cna01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     AB433_10675
    1.1.1.284  S-(hydroxymethyl)glutathione dehydrogenase
     AB433_10675
SSDB
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Met_10 TrkA_N AlaDh_PNT_C MinC_C
Other DBs
NCBI-ProteinID: AKM10310
UniProt: A0A0G3XFK5
Position
2111958..2113067
AA seq 369 aa
MKSRAAVAFGAGQPLEIVEIDVAPPRKGEVLIRVTHTGVCHTDAYTLAGSDPEGVFPVVL
GHEGAGIVVEVGEGVTSVGPGDHVIPLYTAECGKCDFCLSGKTNLCVAVRETQGKGLMPD
GTTRFSYNGQPLYHYMGCSTFSEYTVVAEVSLAKINPEANPEHVCLLGCGVTTGIGAVHN
TAKVQPGDSVAVFGLGGIGLAAIQGARQAKAGRIIAIDTNPSKFELARQFGATECINPKD
HDKPIQQVLIEMTGWGVDHTFECIGNVHVMRAALESAHRGWGQSIVIGVAGAGEEISTRP
FQLVTGRVWKGSAFGGVKGRTQLPGMVEDAMRGDIDLAPFVTHTMGLEEINEAFALMHEG
KSIRTVIHY
NT seq 1110 nt   +upstreamnt  +downstreamnt
atgaaatctcgcgccgctgtagccttcggggcgggccagccactcgaaatcgtcgagatc
gatgtcgccccaccccggaaaggcgaagtcctcatacgggtgacgcacaccggcgtgtgc
cacaccgacgcgtacacgctagcggggagtgatccggaaggtgttttcccggtggttctg
ggccacgagggcgcgggcatcgttgtcgaggtcggtgaaggcgtcaccagcgtcgggccg
ggcgatcacgtgattccgctctacaccgccgagtgcggcaagtgcgacttctgcctgtcg
ggcaagaccaacctgtgcgtcgctgtacgcgaaacgcagggcaagggcttgatgcccgat
gggaccacccgcttttcgtacaatggtcagcccctctatcattacatgggctgttcaacc
ttcagtgaatatactgtcgtcgccgaagtctcgctcgccaagatcaatcccgaggcaaac
cccgaacatgtctgcctgctcggctgcggcgtcacgaccggcatcggcgcagtacacaat
accgccaaggtccagcccggagactcggtcgccgtgttcggcctcggcggcatcggcctc
gcggcgattcagggtgcgcgccaggcgaaggcgggtcgcatcatcgccatcgacaccaat
ccgtccaagttcgagctggcacgccagtttggtgcgaccgagtgcatcaaccccaaggac
catgacaagcccatccagcaggtgctgatcgagatgacgggctggggcgtcgatcatacc
ttcgagtgcatcggcaacgtccacgtcatgcgcgccgcgcttgaatcagcgcaccgtggc
tggggtcagtcgatcgtgattggcgttgccggcgcgggcgaggaaatctccacccgccca
ttccagctcgtcacgggccgcgtatggaaggggtccgctttcggtggcgtcaagggacgg
acacagctccccggcatggtcgaggacgcgatgagaggcgatatcgatctggccccattc
gtaacccacaccatgggtttggaggagatcaacgaggccttcgcactgatgcacgaaggc
aagtcgatccgcacggtcattcactactga

KEGG   Croceicoccus naphthovorans: AB433_13440
Entry
AB433_13440       CDS       T03964                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K00121  S-(hydroxymethyl)glutathione dehydrogenase / alcohol dehydrogenase [EC:1.1.1.284 1.1.1.1]
Organism
cna  Croceicoccus naphthovorans
Pathway
cna00010  Glycolysis / Gluconeogenesis
cna00071  Fatty acid degradation
cna00350  Tyrosine metabolism
cna00620  Pyruvate metabolism
cna00625  Chloroalkane and chloroalkene degradation
cna00626  Naphthalene degradation
cna00680  Methane metabolism
cna01100  Metabolic pathways
cna01110  Biosynthesis of secondary metabolites
cna01120  Microbial metabolism in diverse environments
cna01200  Carbon metabolism
cna01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AB433_13440
   00620 Pyruvate metabolism
    AB433_13440
  09102 Energy metabolism
   00680 Methane metabolism
    AB433_13440
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AB433_13440
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    AB433_13440
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    AB433_13440
   00626 Naphthalene degradation
    AB433_13440
Enzymes [BR:cna01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     AB433_13440
    1.1.1.284  S-(hydroxymethyl)glutathione dehydrogenase
     AB433_13440
SSDB
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 AlaDh_PNT_C 2-Hacid_dh_C TrkA_N
Other DBs
NCBI-ProteinID: AKM11840
UniProt: A0A0G3XJV3
Position
complement(2680057..2681148)
AA seq 363 aa
MESKAAVALAKNERMIIETINVAPPQEGEVLVEIKATGLCHSDLHGMDGSWDFSTGFPGL
FGHEGAGIVREIGPGVSSFKPGDHVLTFIPHCGHCPLCSTGKTNLCYASFVDFLETSRVD
FDGQKLYPFLGLGTFTNFNVFREMSLVKVRDDAPFDELCYFSCGATTGMGAALHTAKVEA
GSTVIVFGLGGVGLNVVQGARLAGATQIIAVDTNPAKEAIARKMGATEFVNPKTVEGDLA
GHLNEISGGGADFTFEVVGNTQLMQLAFECTKIGWGKCTIVGIAPDEARLEVPPTMLVQG
KSLIGSPMGGVTGSQIPAMVDLMMDGKIDVASLITDRLPIDQINEGYDKMKRGEGIRSVV
MFD
NT seq 1092 nt   +upstreamnt  +downstreamnt
atcgaaagcaaggccgccgtcgcattggccaagaacgagcgcatgatcatcgagacgatc
aacgtcgcccccccgcaagagggggaggttctggtcgagataaaagcaaccggattgtgc
cattcggatctgcacggcatggacgggtcgtgggatttctccaccggttttcccggcctt
ttcgggcacgaaggggcaggtatcgttcgcgagattggccctggcgtcagctcatttaag
ccaggtgaccatgttctgacttttattccgcattgcggccactgtccgctgtgctcaacg
gggaagacgaacttgtgctatgccagcttcgtcgattttttagagaccagccgagtagat
ttcgacggtcagaaactttacccgtttcttggcctcggcacttttaccaatttcaacgtc
tttcgcgagatgagcttggtgaaagtacgtgacgacgcgccatttgacgaactgtgctat
ttcagttgcggcgcgaccacgggcatgggtgccgcgttgcacacggcgaaggtggaggca
ggatccacagttattgttttcgggctgggcggagtcggcctgaatgtcgttcagggcgcg
cggcttgcgggcgccacgcaaataatcgccgtcgacactaacccggcgaaagaagcgatc
gcgcgcaagatgggcgctacagaattcgtcaatccgaaaacggttgaaggcgatcttgcc
gggcacctcaacgaaattagcggcggaggcgccgactttacattcgaagtggtgggcaac
acgcagctgatgcaactagccttcgaatgtacaaaaatcggttgggggaaatgtacgatt
gtcggaatcgccccagacgaagcccgacttgaagtaccgcccaccatgctggttcaggga
aaatcgctgattggatcgccgatgggcggggttaccggaagccagatacccgcgatggtg
gacctgatgatggacggcaaaatcgacgtggcaagcctgattaccgatcgtttgccgatc
gaccaaatcaacgaaggctatgacaagatgaagcgtggtgaaggaatccggtcggtcgtg
atgttcgattga

DBGET integrated database retrieval system