KEGG   Croceicoccus naphthovorans: AB433_12805Help
Entry
AB433_12805       CDS       T03964                                 

Definition
(GenBank) phenylalanine-4-hydroxylase
  KO
K00500  phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
cna  Croceicoccus naphthovorans
Pathway
cna00360  Phenylalanine metabolism
cna00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cna00790  Folate biosynthesis
cna01100  Metabolic pathways
cna01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cna00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    AB433_12805
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AB433_12805
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    AB433_12805
Enzymes [BR:cna01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     AB433_12805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biopterin_H
Motif
Other DBs
NCBI-ProteinID: AKM10644
UniProt: A0A0G3XJ68
Position
2540008..2540877
Genome map
AA seq 289 aa AA seqDB search
MKKPGSANSDNELRGDYTAAGRDYVVPQDWDTYTPEMHDRWRRLHQRQSALAEKYASPQF
LEGLGKLDCSYGVPRFEYANLVLGNATGWQLVAVPGFIPDAVFFDHLANRRFPVTRWLRE
ESELDYLVEPDIFHDFFGHVPMLLDPHVADFLALYGKAGERAMEMDALPMLARIYWYTIE
FGLIDTRHGLKAFGAGIVSSAGETVFSVTDPEVLRLNFDPVRIMNTAYKIDDFQANYFVL
DSLKQLLSELVSLDFGPIYETWRDKAPIPAGTLRDGEKPWQGQLARKES
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagcccggctcagccaatagcgacaacgaattgcgcggcgattacaccgcagcg
gggcgcgactatgtcgtgccgcaggactgggacacctacacccccgaaatgcacgaccgc
tggcggcgactgcaccagcggcagagcgccttggccgagaagtacgcttcaccccaattc
ctcgaaggactgggcaagctcgattgctcttacggcgtaccgcgcttcgaatatgcgaac
ttggtgctgggcaacgcgaccggctggcaactggtggcagtgccgggattcattcccgat
gcggtgttcttcgaccacctcgccaaccgccggttcccggttacccgctggctgcgcgaa
gagagtgagctggactatctggtcgagcccgacatttttcacgacttcttcggccacgtc
ccgatgttgctcgacccgcatgtcgccgatttccttgcgctttatggcaaggctggggaa
cgggcaatggagatggacgcgctgcccatgctggcgcgcatctactggtacaccatcgaa
ttcggactgatcgacactaggcacggcttgaaggcatttggcgcgggcatcgtttccagc
gcgggagaaaccgtattttcggtcaccgaccccgaagtgctgcgcctgaatttcgatccc
gtgcggatcatgaacaccgcttacaagatcgacgatttccaggcgaactacttcgttctg
gacagcctgaaacaactgctgagcgagctggtctcgctggacttcgggccgatctacgaa
acctggcgcgacaaggcgccgattcctgccggaacgctgcgcgatggcgaaaaaccgtgg
cagggccagcttgcaaggaaagaatcatga

DBGET integrated database retrieval system