KEGG   Croceicoccus naphthovorans: AB433_13610Help
Entry
AB433_13610       CDS       T03964                                 

Definition
(GenBank) pterin-4-alpha-carbinolamine dehydratase
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
cna  Croceicoccus naphthovorans
Pathway
cna00790  Folate biosynthesis
cna01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cna00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    AB433_13610
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cna04147]
    AB433_13610
Enzymes [BR:cna01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     AB433_13610
Exosome [BR:cna04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AB433_13610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_4a
Motif
Other DBs
NCBI-ProteinID: AKM10765
UniProt: A0A0G3XGV4
Position
2713332..2713616
Genome map
AA seq 94 aa AA seqDB search
MVERIEGEALHAAVADLDGWELRGDQLAIERTYKFADFVEAFGFMTRVAILAEKADHHPE
WFNVYNRVEITLTTHDAGGVSERDVAMAKAIAAL
NT seq 285 nt NT seq  +upstreamnt  +downstreamnt
atggtcgaacgcatagaaggagaagcgctgcatgccgccgtggccgatctggacggatgg
gaactgcgcggcgatcagctggctatcgagcgcacctacaagttcgccgatttcgtcgag
gcgttcggatttatgacccgcgtcgcgatcctggccgaaaaggccgaccaccatcccgaa
tggttcaacgtctacaaccgggtggaaatcaccctgaccacccacgacgcaggcggcgtt
tccgaacgcgacgtggcgatggcgaaagcgattgccgcgttataa

DBGET integrated database retrieval system