KEGG   Cryptococcus neoformans var. neoformans B-3501A: CNBA1040
Entry
CNBA1040          CDS       T01040                                 

Definition
(RefSeq) hypothetical protein
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
cnb  Cryptococcus neoformans var. neoformans B-3501A
Pathway
cnb00100  Steroid biosynthesis
cnb01100  Metabolic pathways
cnb01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cnb00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    CNBA1040
Enzymes [BR:cnb01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     CNBA1040
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295 PEMT ICMT
Other DBs
NCBI-GeneID: 4933355
NCBI-ProteinID: XP_778101
UniProt: Q560Y9
Position
1
AA seq 467 aa
MDAQEESTTTVITATTHLDLPAHPHIKTYQELNPRSKPTEFFGPCGTGAITLFTPLFTYF
FFFACNDAVGCTPTSVQGWKDAFALVGNYPSSAGRLWDWKAAGVYLGWYAFCMICEVVLP
GQRVEGNLLRDGRRKVYRMNGLYTLLLALGLLTGVLVQPRGIQAFTWLHDHFVPLISASL
AMATFQAVWVYVWSFFSGELLALGGNSGNVVYDFFIGRPLNPTIPGFPSFDLKTFNEVRP
GMILWFLLNISCACEQYVRIGKLTDSMWIVLVFEGWYVLDCLLQEHTILNQMDITTDGFG
FMLAFGDLTWVPFTYGLQARFLASTPVELGPVATALIVGVEVAGMYIFRVANNEKADFRA
GKNPKNLEYMQTERGTKLLTSGWWGRSQHPNYFGDWLIALGWCLPTGFNTPLTYFYLVYF
VILLLHRQKRDEEACKLKYGKDWDRYCEKVPYKIIPYVAFELGSIKP
NT seq 1404 nt   +upstreamnt  +downstreamnt
atggacgcccaggaagaatccacgacgacagtcataacagctacaacccacctcgacctc
cccgcacacccacacatcaagacctaccaagagctcaacccccgctcaaagcccacagag
ttcttcgggccatgcggcacaggcgcaatcaccctcttcacgcctctcttcacctacttt
ttcttctttgcctgcaacgatgcagtcggatgcacaccaactagtgtacaggggtggaaa
gatgcctttgcgctggtaggcaactacccgagctcggcaggtaggttgtgggactggaaa
gctgcgggcgtgtatctcggctggtatgcgttctgcatgatctgtgaagtcgtcctgccc
gggcagagagtcgaaggtaatctgttgagggatggacgacgaaaagtctacaggatgaac
ggtctttacactcttctcctcgcccttggtcttcttaccggtgtcttggtccagcccagg
ggtatccaagctttcacttggctccacgaccactttgtgcccctcatctcggccagtctg
gctatggccactttccaagccgtctgggtttatgtgtggagctttttctctggtgagctc
ttggctctcggtgggaactctggcaatgttgtctacgacttctttatcggccgacctctc
aaccctaccatccccggattcccctctttcgacctcaagacattcaacgaagttcgaccc
ggcatgatcctctggttcttactcaacatttcttgcgcttgcgagcaatacgtcaggatc
ggaaaactgactgatagtatgtggatcgtcctcgtctttgagggctggtatgtcctcgac
tgtcttttgcaagagcacacaatcctcaaccagatggacattacaaccgacggcttcggc
tttatgctcgcctttggcgacctcacctgggttccttttacctatggcctccaagcgcga
ttcttggcttccacccccgtcgagctgggtcccgtggcgacagccttgattgtcggtgtc
gaagtcgcggggatgtacatcttcagagtagctaataatgaaaaggccgacttcagggct
ggaaagaaccccaagaacttggaatacatgcagacggagagagggaccaagcttttgact
tctggctggtggggccgatctcagcaccctaactactttggcgactggctcattgctctc
ggatggtgtctccccaccggcttcaacacccctctcacatacttttacctcgtctacttt
gttatccttcttttgcacagacaaaagagggacgaagaggcatgtaaactcaaatatggc
aaagactgggaccgttattgtgaaaaagtgccttacaagattatcccttacgtcgccttt
gaattgggtagtattaagccgtaa

DBGET integrated database retrieval system