KEGG   Cryptococcus neoformans var. neoformans B-3501A: CNBA2340Help
Entry
CNBA2340          CDS       T01040                                 

Definition
(RefSeq) hypothetical protein
  KO
K12897  transformer-2 protein
Organism
cnb  Cryptococcus neoformans var. neoformans B-3501A
Pathway
cnb03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:cnb00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    CNBA2340
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cnb01009]
    CNBA2340
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:cnb03041]
    CNBA2340
Protein phosphatases and associated proteins [BR:cnb01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CNBA2340
Spliceosome [BR:cnb03041]
 Common components
  Common spliceosomal components
   SR proteins
    CNBA2340
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RRM_1 RRM_5 RRM_occluded
Motif
Other DBs
NCBI-GeneID: 4933488
NCBI-ProteinID: XP_778234
UniProt: Q560K6
Position
1
AA seq 287 aa AA seqDB search
MSQPESSVAPPRESYDERAASPLPRDYAEDKYSTRPPPARYDDELRDDSYSAKGGDTYRS
DRPALEAPRRPAQAPPPVNPNPVLGVFGLSIRTRERDLEDEFMRYGDVEKVVIVYDQRTD
RSRGFGFITMRTVDDAARCIEKLNGLSLHGRNIRVDYSATQKPHSSTPGQYMGAKRPAMT
ATVVGAMMIAEEATAIDVTTIAVIITVQVAADTTIEMAATGKESYGSRRTGDPYEGRSRR
DDYSYDKYDKQDKYADYDYDRRSSRRSRYSASPARSTAAPAPEVPRY
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgtctcagccagaatcctctgtcgctccccctcgcgaatcatacgatgagcgagctgct
tctccacttccgcgagactatgcggaggacaagtactctactcgtcctccacctgccaga
tatgatgacgagctgagagatgactcgtattctgccaagggaggcgatacttacagaagt
gatcgccctgcattggaagcaccccgtcgacctgctcaggctccacctccagtcaacccg
aacccagttctcggtgtctttggtctttctattcgcactcgtgagcgagacctcgaggat
gagtttatgagatatggtgatgtggagaaggttgttattgtttatgaccaaaggaccgat
cgttctcgaggattcggctttataacaatgcgaaccgttgacgatgcggcacggtgtatt
gaaaaactgaatgggcttagtcttcacggccgaaacattcgcgtcgactattctgctact
cagaaacctcactcttccacacctggccagtatatgggtgccaagagaccagcgatgacc
gctacggtcgtgggcgctatgatgatcgccgaggaggctacggcgatcgacgtcacgacg
atcgccgtgattattacggttcaagtagcagcagacacgacgatcgagatggcggctaca
ggcaaagagtcttacggttctcgtaggactggtgacccttatgaaggtcgcagcaggaga
gatgattacagctacgataaatacgacaagcaagacaagtatgccgactatgattatgat
aggcgaagttcccgacgaagcagatactccgcttctcctgctcgttctactgctgccccc
gcccccgaagtacctaggtattag

DBGET integrated database retrieval system