KEGG   Cryptococcus neoformans var. neoformans B-3501A: CNBA4640Help
Entry
CNBA4640          CDS       T01040                                 

Definition
(RefSeq) hypothetical protein
  KO
K19704  protein phosphatase PTC1 [EC:3.1.3.16]
Organism
cnb  Cryptococcus neoformans var. neoformans B-3501A
Pathway
cnb04011  MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:cnb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04011 MAPK signaling pathway - yeast
    CNBA4640
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cnb01009]
    CNBA4640
Enzymes [BR:cnb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     CNBA4640
Protein phosphatases and associated proteins [BR:cnb01009]
 Protein serine/threonine phosphatases
  Mg2+- or Mn2+- dependent protein phosphatases (PPMs)
   PPM1 phosphatases (PP2C)
    CNBA4640
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PP2C
Motif
Other DBs
NCBI-GeneID: 4933726
NCBI-ProteinID: XP_777766
UniProt: F5HFX0
Position
1
AA seq 487 aa AA seqDB search
MNQPSTLAQAHPDHPTLAELVADRPDPATATPLGHDIASPQHTTTPTSMSDADSSPASPE
APRRPGGLSEGPNARSKSVTVASGEDTFGALNCHPGPGSAAISNSNLPADSFRVGVSEDR
NRRCRRTMEDAHSFVYDFAGVKGQGYFAVFDGHAGKHAAEWCGQNFHEYLLDGLLIEPDT
PVPDLMNKTFHLVDKRLSHLAHAAGTSSGCTAVTAFLRVEEMDDNDSFRKGFTNPGLQPR
GLWEGKGEDELESQTSLQPSSRRSSMGGGTGGQMGGASAPGVNGRTGSLARRLSSKKIRD
FVKGLTGGMEKNFDEAITEDEGVISAADGTRVEAIEPKSEKGVRRVLYTANVGDARAVLC
RGGKAVRLTYDHKGSDAQEAKRITDAGGFVMNNRVNGVLAVTRSLGDASMKEFVVGAPYT
TETTLDEQDEFLIVACDGLWDVCSDQEAVEIVHLVTDPQEASKRLLDHAMSNFSTDNLSV
MVVRFNH
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgaaccagccgtccacgctcgcacaggcccacccggaccatcccaccctcgccgaactc
gtcgcagaccgccccgaccccgccaccgccaccccgctcggccacgatatcgcgtccccc
cagcacaccaccacgcccacttccatgtccgacgcggactccagtcccgcatccccagaa
gccccccgccgccccggcggcctctccgagggccccaacgccaggagcaagagcgtcacc
gtcgcctcgggcgaagacacctttggcgcgctgaactgccaccctggcccgggctcagcg
gccatcagcaacagcaaccttcccgcggactcgttccgtgtcggtgtcagcgaagatagg
aataggcgatgtaggaggacgatggaggatgcgcatagctttgtctatgactttgccggt
gtcaagggccaagggtactttgccgttttcgacggacacgccggtaagcatgctgccgaa
tggtgcggccaaaatttccacgagtacctcctcgacggccttctcatcgaacccgacact
cccgtccccgacctcatgaacaagacattccatcttgtcgacaagcgtctctcacatctc
gcccatgctgccggtacttcttccggctgtaccgccgtcaccgccttcctccgtgtcgaa
gaaatggacgataacgatagcttccgcaagggattcaccaatccgggcttacagcctcgc
ggcttgtgggaaggtaagggagaagacgaactcgaatcccaaacttccctccagccttcc
tcccgtcgatcttcaatgggtggtgggaccggcggccaaatgggaggggcatccgcaccg
ggcgtcaatggacgaaccggaagtttggcgagacgattgtccagcaagaaaatacgagac
tttgtcaagggcttgacgggtggtatggaaaagaatttcgacgaggctattacggaggat
gaaggtgtgatcagtgcggcagatgggacaagagtagaagctattgagccaaaaagcgaa
aagggtgtcaggagggtgctgtacactgccaatgtcggagacgctagagctgttctttgt
cgcggaggaaaggctgtcaggctgacatatgaccacaagggcagtgatgcccaagaagcc
aagcgaattactgatgctggcggtttcgtcatgaacaaccgagtcaacggcgttctcgcc
gttacacggtctttgggtgatgcctccatgaaagaatttgtcgtcggcgcgccatacact
accgaaacaactctagatgagcaagacgagttccttatcgtcgcctgcgatggcctctgg
gatgtatgctcagaccaagaagccgtcgagattgttcatcttgtcaccgatccccaggaa
gcgtcaaagcgactcttagatcatgccatgtccaacttttcaacagataacttgagcgtc
atggttgttcgcttcaaccactag

DBGET integrated database retrieval system