KEGG   Cryptococcus neoformans var. neoformans B-3501A: CNBA6100Help
Entry
CNBA6100          CDS       T01040                                 

Definition
(RefSeq) hypothetical protein
  KO
K01694  tryptophan synthase [EC:4.2.1.20]
Organism
cnb  Cryptococcus neoformans var. neoformans B-3501A
Pathway
cnb00260  Glycine, serine and threonine metabolism
cnb00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cnb01100  Metabolic pathways
cnb01110  Biosynthesis of secondary metabolites
cnb01130  Biosynthesis of antibiotics
cnb01230  Biosynthesis of amino acids
Module
cnb_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cnb00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CNBA6100
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CNBA6100
Enzymes [BR:cnb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CNBA6100
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trp_syntA PALP His_biosynth
Motif
Other DBs
NCBI-GeneID: 4933874
NCBI-ProteinID: XP_777732
UniProt: Q55Z78
Position
1
AA seq 715 aa AA seqDB search
MAEQLKQVYADKKAQDQAAFVTFLTAGFPTRDATVPLMLALEAGGADIIELGVPFSDPVA
DGPVIQKANNVAIENNVHYSDCIEYVRQARAQGLKAPVLFMGYYNPIIAYGEERAVKDAR
EAGANGYIVVDLPPTEAVDFRNTCTKAGMSYIPLVAPSTSIDRVKFLTSIADSFIYVVSK
MGVTGSSSSENISASLPELVKRIQTFTTIPLAVGFGIDNRTHFDYVTSSGADAVVVGSKI
IKLIFEHADDGLAPKVVEDYCREITLKGQNPPPLGRKNAAAPPPANGGDVSPPLPIPSGS
PLGESQVKVTAAGKLPSRFGLFGGAYVAESLVDCLNELEAAYAEAKEDPAFWKEFEDMFG
YINRPSELYLAERLTEEMGGARIWLKREDLNHTGSHKINNAVGQILLAKRLGKRRIIAET
GAGQHGVATATVCAKFGMECDIFMGAEDVRRQELNVFRIKMLGGRVIPVTAGSQTLKDAV
NEAMRDWVTRLDSTHYLIGSAIGPHPFPTIVRDFQRVIGREIKSQMHEKMGKLPDAVVAC
VGGGSNAIGTFYDFIEDPSVRLVGVEAGGHGIDTEAHSATLTKGVMGVVHGAASYIIQSK
EGQLTPTHSISAGLDYNSVGPEHSHLKYSGRAEYVVADDLQCLKAFKMCTELEGIIPALE
SSHGLWGGMQLAKSLPKDKDIVICLSGNGAKDVAEVLLTLKNKEWADKLDWHVAQ
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atggcagagcagctcaagcaagtatacgcagacaaaaaggcccaggaccaggccgccttt
gtcacctttttgacagctggtttccctacccgcgatgccacagtgcctctcatgctcgcc
ctagaggcaggcggtgctgacattatcgaactcggtgtcccattcagtgacccagtcgcc
gacggtccggtcatccaaaaggccaacaacgttgccattgaaaacaatgtccactactct
gactgtatcgagtacgtccgacaggctcgtgcccaaggtctcaaggctcccgtcttgttc
atgggctactacaaccccatcatcgcttatggcgaggaaagagctgtcaaggacgctcga
gaggccggtgccaacggctacatcgtcgtcgacttgccccccaccgaagccgtcgacttt
agaaacacttgtaccaaggccggcatgtcgtacattcccctcgtcgccccttctacgagc
atcgatcgagtcaagttcttgacttctatcgccgattctttcatatatgtcgtctccaag
atgggcgtcaccggttcctcttcttccgaaaacatctcagcctccctccccgaacttgtc
aagcgtatccagacgttcaccacgatccccctcgctgtcggttttggtatcgacaaccgt
acccactttgactatgtcacatcttccggtgcggatgctgttgtcgttggatccaaaatc
atcaagctcatctttgagcacgccgacgacggtcttgcacccaaggtcgtcgaagactat
tgccgagaaatcacactcaagggccagaaccctccccctcttggccgaaagaatgctgct
gccccgcctcctgccaatggaggtgacgtctctccccccctccccattccctctggctca
cctctcggcgagtctcaagtcaaggtcaccgccgccggtaaactcccttctcgattcggt
cttttcggtggcgcctatgtcgccgaatcccttgtcgactgtttgaacgagcttgaagct
gcgtatgccgaggccaaggaggatcctgcgttctggaaagagtttgaggatatgtttggg
tacatcaaccgacctagtgaactttaccttgccgagaggttgaccgaggagatgggcggt
gcgaggatctggctcaagagggaagatctcaaccatactggttctcacaagattaacaat
gccgttggccaaattctcctcgccaagcgattgggtaagcgaagaattatcgccgagacg
ggtgccggtcagcacggtgtcgctaccgccaccgtctgcgccaagtttggcatggagtgt
gacattttcatgggtgctgaggatgtgaggaggcaagagctgaacgtcttcaggatcaag
atgcttggtggtcgagttatccccgttaccgccggttcccagaccttgaaggacgctgtc
aacgaggctatgagagattgggtcactcgattggactctactcattatcttatcggctcc
gctatcggtccccacccgttccccaccatcgtccgtgacttccagagggttatcggtcga
gagatcaagtctcagatgcacgaaaagatgggcaagttgcctgatgctgtcgttgcctgt
gtcggtggtggctctaatgcgatcggtactttttacgactttatcgaggatccgagtgta
agactggtcggtgtcgaagctggtggtcatggtattgacaccgaggcacactctgctacg
ctgaccaagggtgtcatgggtgtcgtccacggcgccgcttcttacattatccaatcaaag
gaaggccagctcacccccacgcactccatctctgccggtctcgactacaactctgtcggt
cccgaacactctcacctcaagtatagcggtcgagcggaatatgtcgtggcggacgatttg
cagtgtctcaaggcgttcaagatgtgtaccgaattggagggtattattcccgctttggag
agcagtcatggtttgtggggcggtatgcagttggccaagagtttgcccaaggataaggat
atcgtcatctgtttgagtggaaacggtgccaaagacgttgcagaggtgttgttgacgttg
aagaacaaggagtgggcggacaagcttgattggcacgttgcgcagtag

DBGET integrated database retrieval system