KEGG   Cryptococcus neoformans var. neoformans B-3501A: CNBC3020Help
Entry
CNBC3020          CDS       T01040                                 

Definition
(RefSeq) hypothetical protein
  KO
K17623  pseudouridine 5'-phosphatase [EC:3.1.3.96]
Organism
cnb  Cryptococcus neoformans var. neoformans B-3501A
Brite
KEGG Orthology (KO) [BR:cnb00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cnb01009]
    CNBC3020
Enzymes [BR:cnb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.96  pseudouridine 5'-phosphatase
     CNBC3020
Protein phosphatases and associated proteins [BR:cnb01009]
 HAD phosphatases
  Other HAD phosphatases
   CNBC3020
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like HAD
Motif
Other DBs
NCBI-GeneID: 4934967
NCBI-ProteinID: XP_776811
UniProt: F5HHS6
Position
3
AA seq 251 aa AA seqDB search
MTALLAQRVLPQIEYAIFDMDGLLNAILGRYGHTMTWDIKAGVMGKPQRIAAEYILSHFP
DILEKLTVEEFIAEGVQRREELFKRVEPMRGAAELVKGLHAAGIPIALATGSTMPNFIHK
TTHLPHIFSLFPPTSILTADSPEVKRGKPNPDIFLAAAHSLGRDVGTADECTEEQKAERS
RGLVFEDARPGVLAGIAAGMNVIWVPDAELLALNPGETYGATEVLTHLEEWDPTRWGLPP
LPGFNHIPAQP
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgactgccctactcgcacagcgtgtcctgcctcaaatcgagtatgccatcttcgacatg
gatggtcttcttaatgccattctcggtcgctatggtcatacaatgacctgggacatcaaa
gccggtgttatgggcaaaccccaacgtatcgctgcagagtacattctctcgcatttcccc
gacattctggagaaactgaccgtcgaagaattcatcgccgagggtgtgcagaggagagaa
gaactcttcaagcgggttgagcctatgagaggagctgcagaattggtcaaaggtttgcat
gccgctggaatccctatcgccctggctacgggctctaccatgccaaatttcattcataaa
acaacacatcttccccacatcttctctcttttcccgccgacgtcaattctcactgcagac
tctcccgaagtcaagcgtggtaaacccaaccctgatatattccttgcggccgcccattct
ctcggaagggacgtgggcactgctgacgaatgtaccgaagagcaaaaggcggaaagaagt
cgaggattggtgtttgaggatgcccggccaggtgtcttggctggcatcgcggcagggatg
aatgtcatctgggttcctgatgccgaattacttgcacttaacccgggagagacatacggc
gcgacggaagtccttactcatctggaggaatgggatcccactaggtggggtctccctcct
ttacccggtttcaatcacattcctgcccaaccctag

DBGET integrated database retrieval system