KEGG   Cryptococcus neoformans var. neoformans B-3501A: CNBD2070Help
Entry
CNBD2070          CDS       T01040                                 

Definition
(RefSeq) hypothetical protein
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
cnb  Cryptococcus neoformans var. neoformans B-3501A
Pathway
cnb00450  Selenocompound metabolism
cnb00970  Aminoacyl-tRNA biosynthesis
cnb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cnb00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    CNBD2070
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CNBD2070
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cnb01007]
    CNBD2070
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cnb03016]
    CNBD2070
Enzymes [BR:cnb01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     CNBD2070
Amino acid related enzymes [BR:cnb01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   CNBD2070
Transfer RNA biogenesis [BR:cnb03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    CNBD2070
 Prokaryotic type
   Other AARSs
    CNBD2070
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 Anticodon_1 DUF4407
Motif
Other DBs
NCBI-GeneID: 4935596
NCBI-ProteinID: XP_776160
UniProt: F5HIG7
Position
4
AA seq 724 aa AA seqDB search
MSVRNIREAEGLLMEVHDPSKGPVLPKDGQRNVLITSALPYVNNVPHLGNIIGSTLSADV
FARYNRTLNVPTLYICGTDEYGTATETKALEEGVTPYELCTKFHKLHTEIYEWFQISFDK
WGRTSSPEHTEITQGIYRRLHDNGLFRLETTDQTYCVDDKLFLADRFVEGICPNCGYDDA
RGDQCDKCSLTFSSPTQLLNPRCKRNKAHTLSVRPSTHACYRLDLLQPRLVEWMQKARVK
GKWGTNAVITEKGEIVEPRMLGEGLRPSAVTRDLKWGVEVPKVGDEEEDKAMEGKVIYVW
FDAPIGYPSITATYTEEWEKWWKNPDNVELYQFMGKDNVYFHTVLFPAMLLGTEERWTML
HNISSTQYLNYEDTKFSKSRNVGVFGNNARETGQPPEIWRYYLISQRPENSDSSFLWSKF
IAANNNELLANLGNFVNRVVKFINAKLDSKVPGPEDFAGGEVAPPADSLDVDFVTDVNTR
LKEYREQMDDTKLRGGLATAMALSARGNQYLQENSLDNALLASNPKRCAEVLLNAVNLIY
VLSVVFHPFMPNTSEGILRQLNAPARSLPTKFSIDILPGHVLGKAEYLFKKIDNVNGEQE
KKWQRQYGGDAVVADHVAPPGPGGHPEGGKVPKVKDTDAESKKAAHEARRAQLAKEKKAA
QAAADAKKTPEEKELEAKVEAQGKRLAAIKKGLEEGDAEKEMSVAKSLKTELADLRKRLK
GTTI
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtccggaatatcagagaagccgaaggtctcctcatggaggtccatgacccctct
aagggcccagtcctcccaaaggacggacaaagaaacgtccttatcacttctgcgttacct
tatgtgaacaacgtaccacaccttggcaacatcatcggctctactctttccgcggacgtt
tttgcgagatacaatcggacactcaacgtaccgaccctttatatttgcggaaccgacgag
tatggaaccgctacggagacgaaggccttagaagaaggtgtcaccccatacgaactctgt
accaaattccacaaattgcatacagagatttacgagtggttccagatcagcttcgacaaa
tgggggcgtacttcgtctccggaacatactgagatcacccagggaatttacagacgtctc
catgataacggccttttccgtctggaaaccaccgaccagacttattgtgtagatgacaag
ctctttttggctgatcgctttgtggaaggcatctgtcccaactgcggctatgatgatgcc
cgaggtgaccagtgtgacaagtgctcgctcaccttttcatcccctactcaactccttaac
cctcgctgcaaacgcaacaaggcacacaccctctctgttcgaccctctactcatgcctgc
tatcgtttagacctgctccagcctcggctggttgagtggatgcaaaaagcccgtgtcaag
ggaaagtggggaacaaatgcggtcatcactgaaaagggtgagattgtggagccgaggatg
ctaggagaaggtttaaggcctagtgccgtgacgagagatctgaaatggggtgttgaagtt
ccgaaagtcggagacgaagaggaggataaggccatggaaggcaaggtaatctacgtttgg
ttcgatgctcctatcggctatccttcgatcacagcaacctataccgaagaatgggaaaaa
tggtggaagaatcctgacaatgtagagctctatcaattcatgggcaaagacaacgtctac
ttccataccgttctctttccggctatgctgcttggtaccgaagaacgctggaccatgctt
cataacatctccagcactcagtatctgaattatgaggatacaaagttcagcaagagtagg
aacgttggtgtgttcggcaacaatgctcgagagacaggacagcctcctgagatttggagg
tattatctcatctctcaacgaccggagaacagcgactcctcctttttgtggtccaaattc
attgccgctaacaacaatgagcttttggccaatctgggcaactttgtcaaccgagtggtc
aaattcatcaacgcgaaactcgattctaaggtacccggtccggaagatttcgccggtggc
gaagttgctccccctgctgattctctagacgttgattttgtgactgatgtcaacacccgc
ctcaaagagtaccgcgagcaaatggatgacactaaacttcgcggtggtcttgcaacggca
atggctctttctgctcgtggtaaccaataccttcaagaaaattctttggacaatgccctt
ctcgcaagcaaccccaagcgatgtgccgaggttttgctcaatgctgtaaacctcatttat
gtcctgagcgtggtgttccacccctttatgccaaacacatctgaaggtatcttgcggcaa
ctcaacgctcctgcccgatccctgcccactaaattctctattgatattcttcccggacat
gttttgggtaaagccgaatatttatttaagaagatcgataacgtcaatggagagcaggag
aagaaatggcaaaggcaatacggaggagatgctgtggtagcagatcacgttgcgccacca
ggtccaggcggtcaccccgaaggcgggaaagttccgaaagtcaaggataccgacgcagag
tccaaaaaggctgcgcacgaagctcgcagagcccaacttgcgaaagaaaaaaaggctgct
caggctgctgctgatgcgaagaagactcctgaggagaaggagttggaggcaaaggtggag
gctcaaggcaagaggctagcagcgatcaagaagggattagaagaaggtgacgctgagaaa
gagatgagcgtcgcgaagagcttgaaaactgagttggctgatttacgaaagaggctgaaa
ggaactaccatttaa

DBGET integrated database retrieval system