KEGG   Cryptococcus neoformans var. neoformans B-3501A: CNBF4620Help
Entry
CNBF4620          CDS       T01040                                 

Definition
(RefSeq) hypothetical protein
  KO
K14565  nucleolar protein 58
Organism
cnb  Cryptococcus neoformans var. neoformans B-3501A
Pathway
cnb03008  Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:cnb00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    CNBF4620
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:cnb03009]
    CNBF4620
Ribosome biogenesis [BR:cnb03009]
 Eukaryotic type
  Sno RNPs
   Box C/D snoRNPs
    CNBF4620
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Nop NOP5NT NPR3
Motif
Other DBs
NCBI-GeneID: 4937014
NCBI-ProteinID: XP_774574
UniProt: P0CP27
Position
6
AA seq 565 aa AA seqDB search
MLVLTETSVGFVVFKLSSDAKIDNKDLWKEFETPEGANKALKVQAIQRFTSTASAVEDLT
AVQDGRLTDSLSRFLLDTVGGADDGEKKKKKKKIEEMLVVSDPKLAGTINKALSIPVLSD
SSTQDLYRGIRQQLASLLGGVDQKDLNTMSLGLGHSLSRFKLKFSTDKVDTMVIQAIALL
DDLDKEINIYAMRVKEWYGWHFPEMAKIIVDNIAFARVVKAMGFRTNAVTTDFSLLLPED
LEATLKSAAELSMGTEISDSDMTHIHSLCDQVISISEYRTQLSEYLRNRMQAIAPNLTAL
VGELVGARLISHAGSLMNLAKHPASTVQILGAEKALFRALKTKHDTPKYGLIYHASLIGQ
APQKLKGKMARMVATKAALSIRVDALSDADSRSDVSAAEVGISNRVKLESRLRALEHQAG
IQSVRKVVSANGQQGRQQPRFEMSGVTGSYNAATDNVPLNGDLLPTQPATEEVKEEKDEK
KDKKKKRKSEVAEAGDVTMDGDADLSMVAGETKEERRARKEAKKAAKAAKKAAEESGDGD
KKSKKRRADEDEDSEKKKKKKKKDE
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atgcttgtccttacagagacatccgtcggattcgtcgtcttcaagctcagcagcgatgcc
aagatcgacaacaaggacctttggaaggagtttgagacacccgagggtgccaacaaggcc
ttaaaggttcaggccattcagcgatttacatccaccgcgtctgccgttgaagatctcacc
gctgtccaggacggacgattgacagactcactctccaggtttttgcttgacactgttggc
ggtgccgatgatggcgaaaagaagaagaagaagaagaagattgaggagatgttggttgtt
tccgatcccaaattggccggtaccatcaacaaggctctttccatccccgtcctctccgat
tcctctacccaggacctctaccgtggtatccgtcaacagctcgcctctcttctcggtggc
gttgaccagaaagacctcaacaccatgtctctcggtcttggtcattctctctcccgattc
aagcttaaattctccaccgacaaggttgacactatggttatacaggctatcgctttgctc
gatgatttggataaggagattaacatatacgccatgagggttaaggagtggtacggatgg
catttccctgaaatggccaagatcattgtcgacaacattgctttcgctcgtgtcgtcaag
gccatgggtttccgaaccaacgccgttaccaccgacttctctctcctccttcccgaagac
ctcgaggctaccctcaaatccgccgccgagctttctatgggtaccgaaatctctgattct
gacatgacccacatccactctctctgtgaccaagtcatctccatctccgagtaccgcacc
cagctctccgaatacctccgcaaccgcatgcaggccatcgctcccaaccttaccgccctt
gtcggtgagcttgtcggtgcccgattgattagtcacgccggtagtttgatgaaccttgcc
aagcaccccgccagtaccgtccaaatccttggtgccgagaaggccctcttccgcgcgctc
aagaccaagcacgacacccccaagtacggtctcatctaccacgcctccctcattggccaa
gctcctcaaaaactcaagggtaagatggcccgtatggtcgctaccaaggctgccctctcc
atccgtgtcgacgccctttccgacgccgactctcgttcagatgtctctgctgccgaggtt
ggtatctccaaccgggtcaagctcgagtccagactccgtgctttggagcatcaagctggt
atccaaagtgtgcgcaaggtcgtgagtgccaatggccagcaaggaaggcagcagcccagg
ttcgagatgagcggtgttactggttcatacaacgctgctaccgacaacgtccctctcaac
ggtgacctcctccccacccaacctgccaccgaggaagtaaaggaagaaaaagacgagaag
aaggacaagaagaagaagagaaagagcgaagttgccgaggctggtgatgtcaccatggat
ggtgacgcggatctgagcatggtcgctggtgagaccaaggaggagaggagagcgaggaag
gaggctaagaaggctgccaaggctgcgaagaaagctgccgaggagtctggcgatggcgat
aagaagtccaagaagagacgagcagacgaggatgaagacagcgagaagaagaaaaagaag
aagaagaaggacgagtaa

DBGET integrated database retrieval system