KEGG   Cryptococcus neoformans var. neoformans B-3501A: CNBH2420Help
Entry
CNBH2420          CDS       T01040                                 

Definition
(RefSeq) hypothetical protein
  KO
K20184  vacuolar protein sorting-associated protein 41
Organism
cnb  Cryptococcus neoformans var. neoformans B-3501A
Pathway
cnb04138  Autophagy - yeast
Brite
KEGG Orthology (KO) [BR:cnb00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04138 Autophagy - yeast
    CNBH2420
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cnb04131]
    CNBH2420
Membrane trafficking [BR:cnb04131]
 Endosome - Lysosome transport
  Tethering complex
   Hops complex
    CNBH2420
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Clathrin Vps39_1 Vps39_2 Mcl1_mid zf-C3H2C3 zf-RING_2
Motif
Other DBs
NCBI-GeneID: 4937765
NCBI-ProteinID: XP_773790
UniProt: Q55N42
Position
8
AA seq 1036 aa AA seqDB search
MSSSSHSSLSPPSKPAFVHDTPEAGPSVQSLRSRTSSLSSTSSSVSRKGKERARVPNGDD
LDSELSETESGDENSEEEEDDDEEKEGSQSSERSGHESENKDGPSTKEKSSEDDEEQIED
DDEEDSEESSDEEEEEPALKYSRLKGRIPEILAKDSASTISVSPRSVALGTHNGMVHILS
YEGVKINSFRPHAASVTCLRMDESDDFVATSSVEGRVVIHSLSTPESYAFDYKRPMRAVA
LEPDFAKKKSRAFVCGGMAGNLILQEKGWMGYKEQILHSGEGPIWAIEWRRNLIAWANDL
GVKIYDTNTGQRIGYIDRGASAPRAELFKCTLQWKDDQTLLIGWADHIKSVRVRSRPSSQ
ASGNLPPLTVEMTAIYQVDCMISGIAPFGGSYVILAYIAPDRYENEATDDPIEQRRKAAN
RPELRIIDKGEETNADALSLANYHMYGCNDYSLVKSQKPGEEAFLVISPADVIVVRPRDE
ADHIEWLVEKERFQEALEAAEEMQKKHGSALDMKGIGLKYMRHLVSKEQFEQAAELAPKI
LEQDVAAWEKWIDIFVQHQQLPVIIPYIPTQKPRLGRRVYEMVFTHLLINDKQALLKVIA
SWPTEIYDLTTLVDAIQGELQASHDDPVLLECLGELYLINRLPAKALPYFLRIRKPYVFD
LIREHNLFTAVRDQALQLVTFDQERKKAQGKRENQRGEKTDDAEMGSVEGDKSKHGAAIQ
LLVDHVHSIPIERVVHQLETKPHYLYMYLDALLDKDPQYSLPYSDRMVELYAAYDVDRLM
PFLRTSNFYDLEKAYAVCKERDYVPEMVFLLGRMGNNKRALMLLIERLGDVERAIEFAKE
QADEDLWEDLLAYSESRPDFIRALLEHVGAEINPIRLISRIRNGMEIPGLKPALVKILQA
SNLQVSLLEGCQHILNGDCAGLMGQLQKGQTNGLKASFTSTCAVCSKPAFTNSPSLVLIY
ICRHLVHAECVLPEGVDLPVRQENASVAYLLADEGRMGGRRGAAWKARNLGARLGYAAAV
RVRVKQCPVCESKQGH
NT seq 3111 nt NT seq  +upstreamnt  +downstreamnt
atgtcctcgagcagccactcgagtttatcacctccaagcaaaccagcatttgtccacgat
acccccgaagctggcccctccgtccaatcactgcggtctcgcacttcgtccctttcctcc
acctccagctcagtctctcggaagggcaaagagcgcgccagagtacccaacggagatgat
ttggatagtgaattgagcgaaactgaaagtggggatgaaaatagtgaggaggaggaggac
gatgatgaagagaaggaggggagtcaaagctctgaaagaagcggacatgagtcggagaac
aaagatgggccgagtaccaaagaaaaatcaagtgaagatgatgaagaacaaatcgaagat
gacgatgaagaagatagtgaggaatcgagtgacgaagaggaggaggaaccagcactcaag
tacagcagattaaaaggtcggataccagagatcttagccaaagactctgcatctaccata
tcggtgtcaccaagatctgttgctctagggacacacaacggaatggttcacatcttgagt
tatgaaggcgtcaaaatcaactcgttcaggccgcatgcagcgagtgtgacatgtttgcgt
atggatgagagcgatgactttgttgcaacgtcaagtgtagaaggccgtgtggtgattcat
tctctcagcacaccggaatcttatgcttttgactacaagcgtcccatgcgtgcagttgcc
cttgaaccagattttgccaaaaagaagtctagggcattcgtttgcggtggtatggcgggc
aacttgatcctacaggagaagggatggatggggtataaagagcaaattctccattctgga
gagggacctatctgggctattgaatggagacggaacctcatcgcttgggctaatgatctt
ggagtgaagatctacgatactaacaccggccaacgaataggttacatcgatcgcggtgca
tctgcgcctcgtgccgagctctttaaatgcactcttcaatggaaagatgatcagacactt
ctaataggctgggcggatcacatcaagagtgttcgcgtccgctcccgtccttcaagtcag
gcctctggaaaccttcctcccttgactgtcgagatgacggccatctatcaagttgattgc
atgatctctggtatcgcgcctttcggaggctcatacgtcatactcgcatacatcgcgccc
gacagatatgaaaatgaggctaccgatgaccccattgaacagcgtcggaaggcggcaaac
cgaccggaattaaggattatcgataaaggggaagaaaccaatgctgacgcactgagtcta
gccaattatcacatgtatggctgcaatgactattcattggtcaagtctcagaaacctgga
gaggaagcattcttagtcatcagtcctgccgatgtcattgtggtcagaccaagagatgag
gctgaccatatcgaatggctggtggaaaaggaaagattccaagaggcgttggaagcagcc
gaggagatgcagaagaagcatggtagtgcactggacatgaagggaattgggttaaaatat
atgcgacacctcgtgagcaaagagcaattcgaacaagctgcagagcttgcaccaaaaatc
ttggaacaggatgtggcggcttgggaaaaatggatagacatcttcgtgcaacatcaacag
ctacctgtcatcattccatatatcccgacacaaaagcctaggctagggagacgtgtgtac
gagatggtgtttacacatcttttgatcaacgacaaacaggctcttctaaaggtcatcgca
tcgtggccgacggaaatctatgatctcacaacactggttgacgccatccagggagagctg
caggcttcccatgacgatccagttttattagagtgtctgggtgaattatatcttatcaac
cgccttcctgccaaagctctcccgtacttccttcgtatccgcaaaccctatgtctttgac
cttattagagaacacaatcttttcaccgcggttcgagaccaggctctgcaactggttacc
tttgatcaagaacgaaagaaagcccagggcaaaagggagaaccaaagaggcgagaagacg
gatgatgcagaaatggggagtgtagaaggtgacaagagcaaacatggagctgcgattcag
ttactcgttgatcatgtccactctatccctatcgagagagttgtacaccagcttgaaact
aagcctcattatttgtacatgtatctagacgcccttttggataaagatccacaatactct
ttgccatacagcgacagaatggttgagctctatgctgcgtatgatgtcgacagactgatg
cctttcttgcgtacaagtaacttctacgacctcgagaaggcctatgctgtatgtaaagag
cgcgattatgttccagaaatggttttcctcctcggcagaatgggtaacaataagcgagcg
ctgatgcttcttattgagcgtcttggcgatgtcgaaagggcaattgagtttgcaaaagaa
caagccgatgaggatctttgggaagacttgttggcttattcggaaagccgaccagatttc
atccgtgctcttctagagcacgttggcgcagagatcaaccccatccgactcattagtcgc
atccgcaatggcatggagatccctggactgaaacccgctttggtaaaaatcttgcaagca
tccaaccttcaggtctctttgctggaaggctgccaacatattctaaatggagactgtgcc
ggtctgatgggccagctgcaaaagggtcaaactaatggtctgaaagcgtcatttacgagc
acctgtgcggtgtgttcaaaacctgcctttacgaactcaccatcccttgttttgatttac
atctgtcgacatcttgtccatgcggaatgtgtgcttcctgaaggggtagacctaccagta
cggcaagaaaatgcttcagtcgcgtatttgctggcagatgagggccgtatgggcggccgt
agaggcgcagcgtggaaggcaagaaatctcggggccaggttgggctatgcagcggcggtg
agggtccgagtcaagcaatgtccggtgtgtgagagcaaacagggacattag

DBGET integrated database retrieval system