KEGG   Cryptococcus neoformans var. neoformans B-3501A: CNBI2300Help
Entry
CNBI2300          CDS       T01040                                 

Definition
(RefSeq) hypothetical protein
  KO
K10356  myosin I
Organism
cnb  Cryptococcus neoformans var. neoformans B-3501A
Brite
KEGG Orthology (KO) [BR:cnb00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cnb01009]
    CNBI2300
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cnb04131]
    CNBI2300
   03036 Chromosome and associated proteins [BR:cnb03036]
    CNBI2300
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:cnb04812]
    CNBI2300
   04147 Exosome [BR:cnb04147]
    CNBI2300
Protein phosphatases and associated proteins [BR:cnb01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CNBI2300
Membrane trafficking [BR:cnb04131]
 Endocytosis
  Phagocytosis
   Others
    CNBI2300
 Others
  Actin-binding proteins
   Myosins
    CNBI2300
Chromosome and associated proteins [BR:cnb03036]
 Eukaryotic type
  Chromatin remodeling factors
   B-WICH complex
    CNBI2300
Cytoskeleton proteins [BR:cnb04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     CNBI2300
Exosome [BR:cnb04147]
 Exosomal proteins
  Proteins found in most exosomes
   CNBI2300
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Myosin_head Myosin_TH1 SH3_1 SH3_9 SH3_2 SH3_3 AAA_16 AAA_22 IQ SH3_4 NACHT
Motif
Other DBs
NCBI-GeneID: 4938190
NCBI-ProteinID: XP_773616
UniProt: P0CP01
Position
9
AA seq 1274 aa AA seqDB search
MAPSKKAGKKGAVGGFLSGASKPQKVQKADWSEGFTKKKAAGVPDMTLLSTITNEAINDN
LKVRFQNQEIYTYIAHVLISVNPFRDLGIYTNDVLNSYRGKNRLEMSPHVFAIAESAYYR
MTTEKENQCVIISGESGAGKTEAAKRIMQYIAAVSGGAEGGGIEGIKEMVLATNPLLESF
GCAKTLRNDNSSRHGKYLEIMFNGMGQPVGAQITNYLLEKNRVVGQIDDERDFHIFYQFT
KGASAKMKEAFGLQGPEAYAYISRSGCLDVKSINDVSDFQETLRAMQVIGLTSDEQDSIF
RILATILWLGNIDFVEGDDGNAAISDSGVADFAAYLLEVDSAQLQKVLLMRIMETQRGGR
RGSVYEVPQNVAQASSGRDALAKALYNNLFEWIVSRVNISMKPQTPSQYVIGVLDIYGFE
IFQDNSFEQLSINYVNEKLQQIFIELTLKAEQEEYVREQIKWTPIKFFDNSVVCSLIEDR
RPAGIFATLNDATATAHADPSAADNSFIQRSSMLASNPNFEARGNKFLIKHYAGDVLYTV
AGMTDKNKDTLIKDILDLIEGSKDPFLHTLFPDKVDHTSKKRPPTAGDKIKLSANLLVEN
LMNCQPHYIRTIKPNQHRSPTEYDDKAILHQIKYLGLQENIRVRRAGFAYRAEFSKMIQR
FYLLSPATSYAGDYIWTGDDRSGCERILTDAKIKKEEWQMGVTKAFIKNPETLFYLEGER
DRYWHTMASRIQRAWRAYVRRKHEAATKIQRFWRNQREALVYERKRDYGHQVLAGKKERR
RFSLLGMRKFMGDYLDIAGGSAQGEMLRNAATISPAEQVHFSSRAELLVSKLGRSSKLSP
RFLIITDKAVYFVVSQARDGRVSTSLERKIPLVTIKAISMTNLRDDFVALNVNACEEGDP
IFTCVFKTEMITVILTLTGGNMSVNIGPTIDYAKKKDKRAVIKTQKNEAVRGDATYKSHT
IQVGSGEPPNSLSNPMPPRKPKVKKAAKTASSSRPVNSGRPAAVALPGATKPAAPPALSS
MPSHTPVVTKPTAIPTAAIGAARAPPSIPGRAAAPPPPPPPPPPAGPPKEFYKALYNFTG
QEGEMNLVKGEEVEVKEKDDNGWWMVVKNGQEGWAPSNYLKKVEQAPPPPPPPPPPSRPV
AARPPAASSAPTAPAVTNGSAVPSWKAKNAASATPSADSTPPTSRPASSASKVPPAIKAK
PSIPAKPAIPAKPQVGAKPAPAIGGKPPVPTAPKVQPKAASKLGQVAQPAKAPGQLDLAA
AFAKRAARAQQEED
NT seq 3825 nt NT seq  +upstreamnt  +downstreamnt
atggctccttcaaagaaagcaggaaagaagggcgccgtcggcggcttcttatcaggagcc
tctaagcctcagaaggtccaaaaggccgactggagtgaagggttcacaaagaagaaggcc
gcaggtgttcccgacatgactttgttgagcacaatcactaacgaggctatcaacgacaac
ctcaaagtacgattccagaatcaagagatctatacatatattgcccatgttttgatttct
gtcaatccattccgagaccttggtatctatacgaatgacgtcctcaactcatatcgaggc
aaaaaccgtcttgaaatgtcccctcatgtctttgctatcgccgaatcagcctattatcgt
atgacaaccgaaaaagagaaccaatgtgtcattatttctggtgaatcaggtgcaggcaag
accgaagccgccaagaggatcatgcaatatatcgccgcggtgtcaggaggcgccgagggc
ggcggtattgagggaattaaggaaatggttttggccacgaaccctcttttggagagtttc
ggttgtgcaaagactctgagaaacgataattccagtcgacacggtaaataccttgagatt
atgttcaatggcatggggcagccagtcggtgctcaaatcaccaactatcttctggaaaag
aaccgggtggtcggacaaatcgacgacgagcgagactttcacatcttctatcagttcacc
aagggtgctagtgccaaaatgaaggaggcatttggtttacaaggccctgaggcgtacgca
tatatcagtcgaagtggttgtctggatgtcaagagtattaacgatgtgtccgattttcag
gagactttgcgagcaatgcaagtcatcggtctcacatcggatgaacaagattcgattttc
cgtatccttgctaccatcctttggctcggtaacatcgactttgtcgagggcgacgacggc
aacgctgcaatctctgattccggtgtggcggactttgcagcttatttgttggaagttgat
tcggcgcaattgcaaaaagtgctgttgatgagaattatggagacgcaaagaggcggaagg
aggggtagtgtttatgaggttcctcaaaacgtagcccaagcttcttccggaagagatgcc
cttgcaaaggccttatacaacaatttgttcgaatggattgtcagccgagtcaacatttca
atgaagcctcaaactccttctcaatacgtcattggtgtgcttgatatctacggttttgaa
attttccaagataactcattcgaacaactttctatcaactatgtcaatgaaaagcttcag
caaatcttcatcgaactgacattaaaagccgaacaagaggagtatgtccgagaacaaatc
aagtggactcctatcaagttctttgacaattccgtggtttgctctctcattgaagaccgt
cgtcccgccggtattttcgccactctcaatgacgccactgctactgcccacgccgatccg
tctgctgccgacaactctttcattcagagatcgagtatgctcgcttccaaccctaatttc
gaagcacgaggcaacaagttccttatcaaacattatgctggtgatgtgctctatactgta
gcggggatgactgataagaataaggacactctcatcaaggatatcttggatcttatcgag
ggcagtaaggatccattcttacatacccttttccccgacaaggtggatcacacctccaag
aagaggcctccgaccgcaggtgacaagatcaagttgtctgccaacttactcgttgagaac
cttatgaactgtcaaccacactatatccgaacaattaaacccaaccagcaccgctcgccg
acagaatacgatgacaaggccattctacatcaaattaaataccttggtcttcaagaaaat
atccgtgtccgtcgagcaggttttgcctatcgagccgaattctccaagatgatccagcga
ttctacttgctgtcgcctgccacgtcttatgccggtgattacatctggacaggcgatgac
cgttcgggttgtgagaggatattgacggatgccaagatcaaaaaggaagagtggcaaatg
ggtgtaaccaaggcatttatcaaaaatcccgaaaccttgttttacctcgaaggagagagg
gataggtactggcacacgatggcgtcacgtattcaacgtgcttggcgagcgtacgtcaga
aggaagcatgaagcggccaccaagattcaaagattctggaggaatcagcgtgaagcactt
gtgtacgaacgtaagagagactatggccaccaagtgctcgccgggaagaaggagaggagg
aggttcagcttgttgggcatgcgcaaatttatgggagactatctggacatagctggaggg
agtgctcagggagagatgctgagaaatgcggctaccatatctcctgccgagcaagttcat
ttcagctcgagggcggagctgcttgtctccaaacttggtagatcaagtaaactgagtccg
cgattccttatcatcacggacaaagcggtctactttgttgtctcgcaggccagagatggc
cgagtttccacaagtttggagcgcaaaatcccgctggtgacaatcaaggcgatctcaatg
accaacttgcgagatgactttgtagctctcaatgtcaacgcatgtgaggagggtgacccc
atcttcacctgcgttttcaagacagaaatgataaccgtcatcctcaccctgacgggtggg
aatatgtccgtcaacattggtcctacgattgactacgctaagaagaaggataagcgagca
gtcatcaagacgcagaagaacgaggcagtgagaggtgacgcaacatacaagagtcatacc
attcaagttggctcaggagagcctcctaatagcttgtcgaaccctatgcctcctcggaaa
cccaaggtcaagaaggctgcgaagaccgcttcttcgagtcgacccgtaaactctggtcgg
cctgccgctgttgccctccctggtgccacaaagcctgctgctccccctgctctttccagc
atgccctcccacacacctgttgttacgaaaccaactgctatccctacggcagccatcggt
gccgcgcgcgcacctccatccatccccggccgtgcagccgcccctcctccccccccacca
ccgccaccacctgcaggtccccctaaggagttctacaaggctctttataactttactggt
caggaaggagagatgaatttggtcaagggagaagaagtagaggtcaaggagaaggatgac
aatggatggtggatggtcgtaaagaacgggcaagaaggttgggccccgtcaaattacctg
aaaaaggtggaacaggcaccgccaccccctcctcccccaccccccccgtcccgtcccgtg
gcagctcgaccccctgcagcctcttctgctcccactgctcccgccgttaccaacggctcc
gcggtcccctcttggaaagcgaagaacgctgcatctgccacaccttccgcagactctacg
cccccgacttcccgtccagcctcttccgcttccaaggtcccacctgcgattaaggcgaaa
ccttccatccctgccaaacctgctattcctgccaaaccccaagtaggcgcaaaacctgct
cctgcgattggtggcaaaccacctgtgcctacagcaccaaaagtacaacccaaggcagct
agcaaactaggacaagtggcgcaacctgcgaaagctcctggacaattggatttagctgct
gcatttgcgaagagagcagctagggcccagcaggaggaagactag

DBGET integrated database retrieval system