KEGG   Cryptococcus neoformans var. neoformans B-3501A: CNBJ2230Help
Entry
CNBJ2230          CDS       T01040                                 

Definition
(RefSeq) hypothetical protein
  KO
K00560  thymidylate synthase [EC:2.1.1.45]
Organism
cnb  Cryptococcus neoformans var. neoformans B-3501A
Pathway
cnb00240  Pyrimidine metabolism
cnb00670  One carbon pool by folate
cnb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cnb00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    CNBJ2230
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    CNBJ2230
Enzymes [BR:cnb01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.45  thymidylate synthase
     CNBJ2230
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thymidylat_synt
Motif
Other DBs
NCBI-GeneID: 4938566
NCBI-ProteinID: XP_772947
UniProt: P0CS13
Structure
PDB: 

Position
10
AA seq 317 aa AA seqDB search
MTATIDDQEKNQRSNPDHEEYQYLDLIRRIINVGEVRPDRTGTGTVALFAPPSFRFSLAD
NTLPLLTTKRVFLRGVIAELLWFVSGCTDAKMLSSQGVGIWDGNGSKEFLEKVGLGHRRE
GDLGPVYGFQWRHFGAEYTDADGDYKGKGVDQLQRVIDTIKNNPTDRRIILSAWNPKDLP
LMALPPCHMFCQFFVSLPPADSPGSKPKLSCLMYQRSCDLGLGVPFNIASYALLTHMIAL
ITDTEPHEFILQMGDAHVYRDHVEPLKTQLEREPRDFPKLKWARSKEEIGDIDGFKVEDF
VVEGYKPWGKIDMKMSA
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgacagcaacaatcgacgaccaggaaaagaaccaacgatctaacccggaccacgaggaa
tatcagtacctcgatctcattaggcgaatcattaacgtaggagaggttcggccagaccgt
accggtacaggaactgttgctctctttgctcctccttctttccgcttttccctcgccgac
aacacccttcctcttctgacgacgaaacgcgtcttccttcgcggtgtcattgccgagctt
ttgtggttcgtttctggctgtaccgacgccaaaatgctctctagccagggtgtagggatc
tgggatggtaatggaagcaaagaattcctggagaaggtcggacttggccacagaagggaa
ggtgatctgggacctgtatacgggttccagtggagacattttggtgccgagtacactgat
gccgacggagactacaagggcaaaggagtcgaccaattgcaaagggtaatcgacactatc
aagaacaacccaactgacagacggattatcttatcggcttggaacccaaaggatcttccc
ctgatggctcttccgccctgccacatgttctgccaattcttcgtctcacttcctcctgct
gattcaccgggttccaagccaaaactttcttgcttgatgtatcagaggtcttgtgactta
ggccttggtgtcccattcaacattgcgtcttacgcactgctaacccatatgattgccctc
attaccgacaccgaaccgcatgagtttattttacaaatgggagatgcgcatgtgtacagg
gatcatgttgagccattgaagacgcaactggaaagggagcctagagatttccccaagtta
aaatgggctaggagcaaggaagaaattggagacatcgatggtttcaaggttgaggacttt
gtggttgagggatacaagccatgggggaaaatcgacatgaagatgtctgcttaa

DBGET integrated database retrieval system