KEGG   Cryptococcus neoformans var. neoformans B-3501A: CNBJ2910Help
Entry
CNBJ2910          CDS       T01040                                 

Definition
(RefSeq) hypothetical protein
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
cnb  Cryptococcus neoformans var. neoformans B-3501A
Pathway
cnb00500  Starch and sucrose metabolism
cnb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cnb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CNBJ2910
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:cnb01003]
    CNBJ2910
Enzymes [BR:cnb01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     CNBJ2910
Glycosyltransferases [BR:cnb01003]
 Polysaccharide
  Storage polysaccharide
   CNBJ2910
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glycos_transf_1 Glyco_trans_1_4 Glyco_transf_5 Glyco_transf_4 Glyco_trans_4_4
Motif
Other DBs
NCBI-GeneID: 4938634
NCBI-ProteinID: XP_773015
UniProt: F5HDU0
Position
10
AA seq 733 aa AA seqDB search
MPRSVHNPFLFEAAWEVANKVGGIYTVIKTKVPVTVREYGDRLCLIGPLSYKSAPVEVEA
EEPGPGPFGDALRSMQERGVKLLYGRWLIEGAPRVLLFDTGSCYDRMDEWKGDLWNLAGI
PSPPNDHETNETIVFGYMVAWFLGEFAARETDNAIVAHFHEWQAGLAIPLCRKRHIDVTT
IFTTHATLLGRYLCAGSVDFYNNLQYFDVDHEAGKRGIYHRYCIERSSAHCADVFTTVSH
ITAFESEHLLKRKPDGVLPNGLNVVKFAAMHEFQNLHVQSKEKINEFIRGHFYGHYDFDL
DNTIYMFTAGRYEFRNKGVDMFIESLARLNHRLKKMGSKTTVVAFIIMPAATNSYTIEAL
KGQAVTSQLKDCVEQVTNRISKRIFEHACRYSGEHGTEVPNPEDLLSNEDRVLLKRRVFA
LKRNSLPPIVTHNMADDANDPILNQLRRVQLFNRPEDRVKVIFHPEFLNSNNPILGLDYE
EFVRGCHLGVFPSYYEPFGYTPAECTVMGIPNITTNLSGFGCFMEDLLESPEDYGCYIVD
RRGQGIEESVDQLTGQLLSFTTKSRRQRINQRNRTERLSELLDWKSLGLEYAKARQLALR
RAYPDSFNDDEPDFTGVQKVGAPLSAPASPRMRTGMMTPGDYATLTEEMEHLSTQDYMGA
KSWKGINDDDDENHYPFPLVMKPRKRSDSLASAISGNATPSGGRKLSENDLARADAALSN
VEGVHADGINGHH
NT seq 2202 nt NT seq  +upstreamnt  +downstreamnt
atgcctcgttccgtccacaacccgttcctttttgaggctgcttgggaagttgccaacaag
gtcggaggtatttacaccgtcatcaagaccaaggtgcctgttactgtcagagaatacggt
gaccgcttatgtttgattggccccttgtcttataaatctgctcctgtagaagtcgaagcc
gaggagcctggaccgggaccgttcggagatgctctcaggtctatgcaggagcgcggcgtc
aagcttctttacggccgatggcttattgaaggcgcccctagagtgttgctctttgacacg
gggtcttgttacgaccgtatggacgaatggaagggtgacctctggaaccttgccggtatc
ccctcgcctccaaatgatcacgagaccaacgaaactatcgtctttggctacatggtcgcc
tggttcctcggcgagttcgctgctcgcgaaaccgacaacgccatcgttgcccacttccat
gaatggcaagccggtttagccatccctctttgtaggaagcgacacattgacgtcaccacc
atcttcaccacccacgcgactcttttgggtcgttacctctgtgctggcagtgtcgacttt
tacaacaacttgcagtactttgacgttgatcatgaagctggtaagcggggtatctaccac
cgttactgtatcgaaaggtcttctgcacactgcgccgatgtgttcaccaccgtcagccac
attaccgcgtttgagagcgaacacttgttgaagaggaagcctgatggtgtcctccccaac
ggtctcaacgttgtcaagtttgccgccatgcacgaattccagaatttgcatgttcagtcc
aaggagaagatcaacgaattcattcgtggtcatttctatggtcactatgactttgacctg
gacaacaccatttacatgttcactgctggtcgttacgagttcaggaacaagggtgtcgac
atgttcattgaaagtttagctcggttgaatcatcgcttgaagaagatgggctccaagacc
accgtcgtcgcattcatcatcatgcccgccgctaccaactcttacactatcgaagctctc
aaaggtcaagctgtcacctcccagctcaaggactgtgtcgagcaagtgaccaatcgtatc
agcaagcgaatctttgaacacgcctgtcgatactctggcgagcacggtacagaggttcct
aatcctgaagatttgctctccaacgaggacagggttttgctcaagcgaagggtgttcgcc
ctgaagcgaaactctctgccgcctatcgtcacgcacaatatggcggatgacgcaaatgac
cctattttgaaccagctcaggagggtacagttgttcaacaggcccgaagacagggtcaag
gttatcttccaccccgaattcttgaacagtaacaaccccatcttgggtctggattatgaa
gagtttgttaggggttgtcacttgggtgttttccctagttactacgagcccttcggttat
acccccgccgagtgtactgtcatgggtattcccaacatcactaccaacttgtccggtttc
ggttgctttatggaagacctcctggagtctcccgaggactacggttgttacattgtcgac
cgacgaggtcaaggtatcgaagaatctgtcgaccagctcaccggccagctgctctctttc
accaccaaatccagaagacagcgtatcaaccagcgtaaccgtactgaacgcctgagcgag
ttgctggactggaagtccctcggtctcgagtacgccaaggctcgtcaattggctttgagg
cgagcttaccccgactcatttaatgatgatgagcccgacttcactggtgtgcaaaaggtt
ggcgcgccgctctctgcgcctgcgagcccgaggatgaggactgggatgatgactcctggg
gattatgccactttgactgaagagatggaacatctttctactcaagactacatgggtgct
aagagctggaaaggcatcaacgatgatgatgacgagaaccattatcctttccctctcgtc
atgaagccccgtaaacgctccgactctctcgcttctgccatctctggtaacgctacccct
tctggcggtaggaagctctccgaaaatgatttggccagggccgatgctgctttgagcaat
gttgagggggttcacgccgacggaatcaacggacatcattag

DBGET integrated database retrieval system