KEGG   Cryptococcus neoformans var. neoformans B-3501A: CNBK3370Help
Entry
CNBK3370          CDS       T01040                                 

Definition
(RefSeq) hypothetical protein
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
cnb  Cryptococcus neoformans var. neoformans B-3501A
Pathway
cnb00052  Galactose metabolism
cnb00500  Starch and sucrose metabolism
cnb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cnb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    CNBK3370
   00500 Starch and sucrose metabolism
    CNBK3370
Enzymes [BR:cnb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     CNBK3370
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-GeneID: 4939038
NCBI-ProteinID: XP_772633
UniProt: F5HDU7
Position
11
AA seq 519 aa AA seqDB search
MFRSLVPVTIAGLAYVLQSLAQSTTSSAASVPTGVPIDGDYSGPYRPRVHFSPPKGFMND
PNGLHKDGNGTWHLYYQYNPTDIVAGNQHWGHATSPDLYHWTNQPIALFPPNSSSGVFSG
SAVIDTNNTSGFFPDQDNGVVAIYTLNTPTAQVQQIAYSKDGGYSFEEYEGNPVLDVGLT
QFRDPKVIWYEDHWVMVVAFPVDYVIGVYTSPDLKSWTHASNITHVGFLGLQYECPNMVS
IPIANSSDSSWVLTISINPGSPLGGSITQYFPGEFNGTHFTPYDSAARLTNFGKDDYAGQ
FFYDEPVSIGWASNWQYTNFVPTGEEGWRSAMTLPRKNYFTNITAAGWDLVQEVYDLSPV
LGDQLDTQQLVNKSSTATITEAAYIDVNFTIPDDASFAEYASLNFTVSTNSSGETVKGGY
FFAEPYSIAAWLDRRDTKAFESPFFTDKFSVAPAQQAKRLQVIIDRSLIEIYIDNGALVG
TMVAFPEEPFTKLEVTTAGLPDGMEVEVGVWDLKDSWTS
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgttccgctccctcgtccccgtcaccatcgccggtctggcatatgtccttcagagtcta
gctcagtccacaacgtcaagtgctgcctctgtccctactggagtccccatcgatggagac
tactctgggccttaccgccccagggttcatttctcacccccaaaaggatttatgaatgat
ccgaacggtctgcacaaggatggcaacggaacttggcatctgtactaccagtataaccca
actgatatcgtggccgggaatcaacactggggccatgccacctctcccgacctctatcat
tggaccaaccagcctatcgccctcttccctcccaattcttcctcgggagtcttttccggt
tcggctgtcattgataccaataatacctctggtttcttccctgatcaggacaatggcgtt
gtagccatttacaccctcaataccccaactgcccaggtccagcagattgcctactctaaa
gatggtggctattccttcgaagagtatgaaggtaaccctgtcttggatgtcggattgact
cagttccgagatcccaaagttatctggtacgaggaccattgggtgatggtcgtcgctttc
cctgtagactacgttattggcgtctacacctctccggacctcaaatcatggacacacgcc
tccaacatcacccacgtcggtttccttggccttcaatacgaatgccctaacatggtgtcc
atcccaatcgccaactcctctgattcctcttgggtactcactatctccattaatcctggt
tcaccacttggcgggtctatcacgcagtatttccccggagagttcaacggtacccacttt
actccctatgattctgctgcgagactcacaaactttgggaaggacgactatgccggtcag
ttcttctatgatgagcctgtcagtattggatgggcatccaactggcagtatacaaacttt
gtaccgacaggcgaagaaggttggaggagtgcgatgacattgccgaggaagaattacttt
acaaacatcactgcagccggatgggatctcgttcaagaagtgtacgacctttctcccgtc
cttggggatcaacttgatacccaacaactcgtcaacaagtcctccactgctactatcact
gaggccgcatacatcgacgtcaactttaccatccctgatgatgcctctttcgcggaatat
gcgtcgctcaacttcaccgtttctacgaacagctcaggcgagacggtgaaagggggttac
ttttttgcggaaccttattccatcgccgcatggcttgataggagagacacaaaggcgttc
gaaagtccttttttcaccgacaagttctcggtagctccagctcaacaagcaaaaagactc
caagtcatcatcgatcgcagcctaatcgagatctacattgataatggtgcattggtgggc
accatggttgcttttccagaggagccattcacaaaacttgaggttacgacggccggtttg
ccggatggtatggaggtagaggtgggggtttgggatttgaaagatagttggacatcatga

DBGET integrated database retrieval system