KEGG   Cryptococcus neoformans var. neoformans B-3501A: CNBL0740Help
Entry
CNBL0740          CDS       T01040                                 

Definition
(RefSeq) hypothetical protein
  KO
K01179  endoglucanase [EC:3.2.1.4]
Organism
cnb  Cryptococcus neoformans var. neoformans B-3501A
Pathway
cnb00500  Starch and sucrose metabolism
cnb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cnb00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CNBL0740
Enzymes [BR:cnb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     CNBL0740
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_9 Adeno_E3_CR2
Motif
Other DBs
NCBI-GeneID: 4939123
NCBI-ProteinID: XP_772459
UniProt: Q55JB1
Position
12
AA seq 590 aa AA seqDB search
MLIPFLALASLSRITTAQLTPSPTYSPPTSSAGLTASSETPNTQWSNILGNSLWFYDAQR
SGRLDEGTYGNRVDWRNDSALEDGSDWGLDLVGGWYDAGDYIKATFPLSFTLFALSWGAL
THGQGYGLANQTAYLDGTLRWGFDWLMKAHPSDDVLFIQVGSGDVDNNYWGGDQDIPSPR
PGYPINSSYPGTDGWAAASAAFSLGSLLYTPGVSYRPTSSSSPPTSPSLENSTYASQLLA
HAESLYSVANSTTPRQTYYTALGDEVAAYASSDWRDNLCASALALALATNNSAYYADAYN
YYVQYGLSGTHEVWNWDSSQPAIYVMFAEIASAKPELAQGAGLDVNLTGWQTEVENYFDG
LIKEDFSNSYLTEGGLLYWDGDSDEASLNPAMAAAMLMFKYAPMASSTDKTNSYNSFAQS
QLNYLLGSNPMSVPYIVGQHPNSPSNPHSAPASGGFNINNIRDDPPTEAHVLYGAVVGGP
LSSDQFWDWRDDWVQTEIALDYNAMIPTLASMQLMNNTADPPYVDIAAGTYSIPSGQPCD
AALPCRGGGGLSGGEIAGIVVGVIVGVVLLVIVGVWWWWRKRGKRWGSKW
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atgctcatccccttccttgccctcgcttctctgtcccgaataaccacagcccagctcaca
ccgtctcccacttattctcctccaacctcctctgcaggactcacagcctccagcgaaaca
cccaacacacaatggtccaatatccttggtaactccctttggttctacgatgcccaaagg
tcaggtagattagatgaaggaacatatgggaacagagtagactggaggaatgatagcgct
ttagaagatgggagtgattggggtttggaccttgtcggcggatggtatgatgcgggtgac
tacatcaaggcgacatttcctttgagttttaccttatttgcgctctcctggggggcgttg
acgcatggccaaggatatggccttgccaaccaaacagcctatctcgatgggaccttgcga
tggggttttgattggcttatgaaggcacacccatcggatgatgtgctgtttatccaagtt
ggttctggggatgtcgacaacaattactggggcggggaccaggacattccaagtcctcgc
ccggggtacccaatcaactcttcttaccctggtacagatggctgggccgctgcctctgcc
gccttttcactaggttccctcctttacacaccaggcgtctcgtacagacccacttcatcg
tcctctcctccaacctcaccttcattggaaaactccacttatgcgtctcagctgttggca
cacgctgagtcgctttactctgtcgccaactctaccacccctcgacaaacttactacacg
gctttaggtgatgaagttgccgcttacgcctcttccgactggcgagataacctctgtgca
tctgctctggctctggcactggcgacaaacaactctgcgtactacgccgatgcatacaac
tattatgtccaatatgggctgtcaggcacacatgaagtttggaactgggattcgtcacag
ccggcaatttatgtcatgtttgcggaaattgcgagcgcaaagcccgagttagcgcaagga
gctggactcgacgtgaacttgactggatggcagactgaagtcgagaactactttgatggg
cttatcaaagaggatttcagtaattcttacttgaccgaagggggattactctattgggat
ggcgactctgacgaggcgtccttgaaccctgccatggctgccgctatgctcatgttcaag
tacgcacccatggcctcttcaaccgacaagaccaactcttataattcattcgctcaatcc
caactcaactacctgctcggctccaaccccatgtcagtcccttacatcgttgggcaacac
ccgaattccccatccaacccccactctgcccccgcttctggtggcttcaacataaataat
atccgtgacgaccctcccaccgaggcgcacgtgttatatggtgcggtggtgggtggaccg
ttgagcagtgatcaattttgggattggagagacgattgggtgcagacggagatagcattg
gattataacgcgatgattccaactctcgcctctatgcagcttatgaacaacactgccgat
ccaccttatgtcgacatcgctgcaggcacatactccatcccctctggccaaccttgtgat
gcagctcttccatgccgcggtggcggcggtcttagcggtggtgagattgcagggattgtt
gtgggtgttattgtgggtgtggtcttgttggtgattgtgggcgtttggtggtggtggagg
aagaggggaaagagatggggtagtaagtggtaa

DBGET integrated database retrieval system