KEGG   Cryptococcus neoformans var. neoformans B-3501A: CNBM0750Help
Entry
CNBM0750          CDS       T01040                                 

Definition
(RefSeq) hypothetical protein
  KO
K14298  mRNA export factor
Organism
cnb  Cryptococcus neoformans var. neoformans B-3501A
Pathway
cnb03013  RNA transport
Brite
KEGG Orthology (KO) [BR:cnb00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    CNBM0750
Messenger RNA biogenesis [BR:cnb03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     CNBM0750
Chromosome and associated proteins [BR:cnb03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    CNBM0750
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 ANAPC4_WD40 Nup160 Ge1_WD40 eIF2A Glu_cyclase_2
Motif
Other DBs
NCBI-GeneID: 4939435
NCBI-ProteinID: XP_772155
UniProt: F5H9I6
Position
13
AA seq 366 aa AA seqDB search
MLSTFRTGVKDIELANPPTDSISRIEFSPTADILAVASWDNNVRLYDVNSQGQNQGKAMY
SHQAPVLDLTWSADGQYVFSSGCDNAAQMYNVQTQQAQQVAQHDAPIKCVEFAEVPGSGQ
VLITAGWDKKLKYWDLRSPNPIATIDLSDRAYSMSVAQQLLVCATGDRQLHVINLSSPTT
IFKSIESPLKWQTRVVSCFPTGDAFAVGSIEGRVAIQYPGEDDKRNFSFKCHRYDIPTGS
MPRTPAVSGSQNVFAINSLTFHKVQGTFCSGGSDGSLTFWDGISRTKLKTFSCKDLNNGD
TDVRPPRFGTPIVSTSFNRTQEIIAYAMSYDWSKGHSGVPPAGQNINKVMLHPVKPEEVN
KKPKRN
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgctctctaccttccgaaccggcgtcaaggatattgaactcgccaaccctcctacagac
tcaatctctagaatcgaattctctcccaccgccgacatacttgctgttgcgagttgggac
aacaatgtgcggttatacgacgtaaactcgcaagggcagaaccaagggaaggcgatgtac
tctcatcaggctcctgtgcttgatttaacttggtcggcagacggccaatatgtcttctcc
tccggatgcgacaacgctgctcaaatgtacaacgtccaaacacagcaagcacaacaagta
gctcaacatgatgcacccataaagtgtgttgaatttgccgaagtgccgggaagtggacag
gttttgattacagcgggttgggataagaaactcaagtactgggacttgagatcacccaac
cctattgcaactatcgacctctctgatagggcctattcgatgagcgttgctcaacaactg
ttggtctgtgctaccggtgaccgtcaactgcatgtcatcaatctttcaagccctaccacc
atcttcaagagtatcgagtcaccgttgaaatggcaaacacgagttgtcagctgttttcct
actggagacgcattcgctgttggaagtattgagggacgagtagctatccaataccctgga
gaggatgataagcgaaatttctctttcaaatgtcatcgatacgacatccctactggtagc
atgccgcgaactcccgccgtcagcggctcccagaatgttttcgctatcaactctctcact
ttccacaaggtgcagggaactttctgctctggtggcagcgacggtagtttgacattctgg
gacggtatctctcgaacaaagcttaagactttctcctgcaaggatttgaacaacggagac
acagatgtacgaccaccaagatttggtactcccatcgtgtctacttcctttaaccgaacc
caagaaatcatcgcgtatgccatgtcatatgattggtccaagggccacagcggtgtccca
cctgcgggacaaaacattaacaaagttatgttgcaccctgtcaagcctgaagaagtcaac
aagaagcccaagaggaattaa

DBGET integrated database retrieval system