KEGG   Cryptococcus neoformans var. neoformans B-3501A: CNBM2130Help
Entry
CNBM2130          CDS       T01040                                 

Definition
(RefSeq) hypothetical protein
  KO
K17583  nucleolar MIF4G domain-containing protein 1
Organism
cnb  Cryptococcus neoformans var. neoformans B-3501A
Brite
KEGG Orthology (KO) [BR:cnb00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cnb01009]
    CNBM2130
Protein phosphatases and associated proteins [BR:cnb01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CNBM2130
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MIF4G MA3 GvpL_GvpF
Motif
Other DBs
NCBI-GeneID: 4939575
NCBI-ProteinID: XP_772056
UniProt: F5HHJ7
Position
13
AA seq 867 aa AA seqDB search
MAPFGGRGSSGRGRGGFRGGRGGRGGRGGYGGPQLPSSLLEQVDAKYGSGGKKDVTRKEK
RKATRDDRKGPAQTQKTRRRSPPSDHEEEEKDESEQPPFKKSKTSKPKSVSSSEKSNSEK
KEKKKKLPELTLPEESVGGDVEDREIEWLEYMLRKEKGKSKDEDDLDDGLDDLLNFAEAF
EHGGKGVNKQILDDEDDEGISDFGEENEDDGEEEESEEDQDEDGGEDNEIDDEEEEFMGF
SDQDDQEKEEDESSAQEKHQAGHDDAEPSVPSDPTPSSSTDTPAPTKYIPPHLRAAQLEE
KSKGNKEKAEEKIRLERKAQGLLNRLSEQNIESILAELETLYRNHSRNDVTTALTDLIIQ
MISNKANLLDSFVVLYATLVGALHRVIGMEFGAHFIHTLITKYSGLQSPSSLSVESQQST
TIQTTIYQTPDAGKESLNLLTLIAELYNAQVVGSRLIYDLIRGFLEGEEKDREVMGEREV
EGLLKILRCSGAQLRTDDPASLKDIVNLVQEKTKGKEKTMTARARFMVETLTNVKNGKVK
SSATSEAGNDAAQRMKKFLSGLGLLAYEPLRVSYSDLLSADKKGKWWLVGAGWSGNPLVE
LEQQREQAKSSGKTEKTGKKKEEKDSEAALLELARKQGMNTDVRRGVFVVLMTSEDYVHA
CDRLSMFKLSDVQQREFVRVALHCCGLEATYNPYYTLILSHLCANSYDHRFTFQYALWDF
MRELENGSKVSKEKLGNVARAVGYVVARGGLSLTVFKAVDFTSLSKPLIKFLITVLVHLV
IALQTVSPIFTLPKSYDLARNFDDEVIQERFEQVLSNTELAGGWLWMLDREMKDGKKWEE
EVTGERERVVVKKSLEIAQNVLRAAAL
NT seq 2604 nt NT seq  +upstreamnt  +downstreamnt
atggccccatttggaggacgcggaagctctggaagaggacgtggtggatttcggggggga
agaggtgggaggggagggagaggaggatatggaggacctcaattgccgtcatctcttctt
gagcaagttgatgccaagtatggatccgggggaaagaaagatgtgaccaggaaagaaaaa
cgaaaagccactcgagatgaccgtaaaggacctgcgcaaactcaaaagacaagaagacga
tcaccaccaagcgatcatgaggaggaggaaaaagatgagtctgaacagccgccttttaaa
aaatcaaagacctccaaacccaaatctgtgtcgagttcggagaagtccaattcggaaaaa
aaggagaagaagaagaagcttccagagttgacacttcccgaggagagtgtgggtggggat
gtggaggacagagagattgaatggttggagtatatgctgaggaaagagaaggggaagtct
aaggatgaggatgatcttgatgatggtctcgatgatttgttaaactttgccgaagctttt
gagcatggtgggaaaggagtgaacaagcagattttggatgatgaagatgatgaaggaata
tctgactttggagaggaaaacgaagatgatggggaagaagaagaatcggaggaagaccaa
gacgaagacggtggtgaagacaacgagattgacgacgaagaagaagagtttatgggattc
agcgatcaagacgaccaggagaaggaagaggatgaatcctcggcccaagaaaagcatcag
gccggacacgacgacgcagaaccatcagtaccttcagatcccactccttcatcctcaacg
gacactccggcacctaccaagtacatccctccacaccttcgagccgctcaattagaggaa
aaatcgaaagggaacaaggaaaaggcagaggaaaaaatacgacttgagagaaaggcgcag
ggtctgctcaataggctgagtgagcaaaatattgagtccatattagccgagcttgaaacg
ctatatagaaatcacagtagaaacgatgtcaccaccgctcttaccgacctcatcattcaa
atgatctccaataaagccaaccttctagattcctttgtcgtcctctacgccactttggtc
ggggctcttcatcgagtgatcggtatggagtttggagctcacttcattcacaccttgatt
acaaaatacagcggtctccagagcccctcgtcattgagcgttgaaagtcaacaatcgaca
actatccagaccacgatttaccagacccctgacgcaggcaaagagtctctcaatttgctc
actctcattgcagagctgtacaacgcccaagttgtcggatctcgattgatctacgatctg
atcagaggcttcttagagggcgaagagaaagaccgagaagttatgggagagagggaagta
gaagggttgctgaagattctgaggtgttcgggagctcagctgagaacagatgaccctgcg
agtttgaaggacattgtcaatcttgtacaggagaagaccaagggcaaggagaagactatg
acagctcgtgctcgtttcatggtggaaaccctaaccaacgtaaaaaatggcaaggtcaag
tcctctgctacttccgaagcagggaacgatgctgctcaacggatgaagaagttcttatcc
ggattaggcctacttgcatacgagcccctccgagtctcctactctgacctgctgtcagct
gataaaaagggtaaatggtggcttgtcggtgcgggctggtctggcaaccctcttgtggag
ctggaacaacaacgtgaacaagccaagtcgtcaggaaagacggagaaaaccggaaagaaa
aaggaagagaaggatagcgaggcggcattgctagagttggcgagaaaacaagggatgaac
acggacgtcagaagaggagtgttcgtggtgctgatgaccagcgaagactatgtgcacgcc
tgtgataggttgagtatgttcaaactgagcgatgtccagcagcgagaatttgtgagggtg
gctctccactgttgtggtctcgaagcaacgtataacccatactatactcttatcctcagt
catctctgtgcaaactcttacgatcaccgcttcacgtttcaatacgctctgtgggacttt
atgcgtgagctggagaatggatcaaaggttagcaaagagaaacttggaaatgtggcgagg
gctgtggggtatgttgtggcccgaggaggactgagtttgactgttttcaaggcggttgat
ttcacatccctttccaaaccgctcattaaattccttatcaccgtcctggtacatcttgtc
atagcgctccagaccgtgtctcccatctttacgcttcctaaatcttatgatcttgctcgc
aactttgatgatgaagttattcaagagagatttgaacaggtgctcagtaacactgagctt
gctggtggttggctgtggatgttggacagggaaatgaaggatggaaagaagtgggaagag
gaagttacgggagaaagggaaagggtagttgtgaagaaaagcttggagattgctcagaat
gtgctgagagcagctgcgctatag

DBGET integrated database retrieval system