KEGG   Cryptococcus neoformans var. neoformans B-3501A: CNBN0210Help
Entry
CNBN0210          CDS       T01040                                 

Definition
(RefSeq) hypothetical protein
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
cnb  Cryptococcus neoformans var. neoformans B-3501A
Pathway
cnb00480  Glutathione metabolism
cnb00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:cnb00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    CNBN0210
  Metabolism of other amino acids
   00480 Glutathione metabolism
    CNBN0210
Enzymes [BR:cnb01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     CNBN0210
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-GeneID: 4939620
NCBI-ProteinID: XP_771839
UniProt: F5HCE3
Position
14
AA seq 151 aa AA seqDB search
MSDIYSYSVEFPKSTLPLSDLKGKTLLFVNVASKCGLTPQYKDLQALHEKYGDKGLAIIG
FPCNQFKAQEPGTDDEVLQFCQVNYGVTFPIAKKGDVNGENTQPIWKYLKENAEPPVSDI
DWNFSKFLVKDGKITWFPARSTKVSDVEAAL
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
atgtctgatatctactcttactctgttgagtttcccaagtccactcttccccttagtgac
ctgaagggcaagactctcttgttcgtcaacgttgcgagcaagtgcggtttgactcctcag
tacaaggatcttcaagctttgcacgagaagtacggtgataaggggctggcgatcattggt
ttcccttgcaaccagtttaaggctcaagagcctgggaccgatgatgaggttcttcagttc
tgtcaagtcaactatggagtgactttccctattgctaagaagggcgacgttaatggcgaa
aacactcagcctatctggaaatacctcaaagagaatgccgagccccctgtctctgacatc
gactggaacttttccaagttccttgtcaaggatggaaagatcacttggttccctgcccga
agcaccaaggttagcgatgttgaggctgctctttga

DBGET integrated database retrieval system