KEGG   Cupriavidus necator N-1: CNE_1c03480Help
Entry
CNE_1c03480       CDS       T01564                                 

Gene name
gpmA
Definition
(GenBank) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase GpmA
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
cnc  Cupriavidus necator N-1
Pathway
cnc00010  Glycolysis / Gluconeogenesis
cnc00260  Glycine, serine and threonine metabolism
cnc00680  Methane metabolism
cnc01100  Metabolic pathways
cnc01110  Biosynthesis of secondary metabolites
cnc01120  Microbial metabolism in diverse environments
cnc01130  Biosynthesis of antibiotics
cnc01200  Carbon metabolism
cnc01230  Biosynthesis of amino acids
Module
cnc_M00002  Glycolysis, core module involving three-carbon compounds
cnc_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cnc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CNE_1c03480 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    CNE_1c03480 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CNE_1c03480 (gpmA)
Enzymes [BR:cnc01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     CNE_1c03480 (gpmA)
Membrane trafficking [BR:cnc04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    CNE_1c03480 (gpmA)
Exosome [BR:cnc04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   CNE_1c03480 (gpmA)
  Exosomal proteins of melanoma cells
   CNE_1c03480 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AEI75714
UniProt: G0EUK3
Position
1:complement(346489..347235)
Genome map
AA seq 248 aa AA seqDB search
MYKLVLIRHGESTWNLENRFTGWVDVDLTETGADQARQAGKLLKDAGLGFDVAYTSVLKR
AIRTLWHVQDEMDLMWIPVRNEWRLNERHYGALAGLNKAETAAKFGDEQVLVWRRSYDTP
PPALEPTDPRASYDDPRYANVPRNEIPLTECLKDTVARVMPLWNESIAPDIQSGKRVVIA
AHGNSIRALVKYLDQISDDDIVGLNIPNGTPLVYELDADLRPLRHYYLGDQDAIAASLAA
VASQGKAR
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgtacaagctcgtcctcatccgccacggcgaatccacgtggaaccttgaaaaccgcttt
accggctgggtcgacgtcgacctgaccgaaaccggcgccgaccaggcgcgccaggccggc
aagctgctcaaggatgccggcctgggctttgacgtggcctatacctcggtgctcaagcgc
gccatccgcacgctgtggcatgtgcaggatgaaatggacctgatgtggatcccggtgcgc
aacgaatggcgcctgaacgagcgccactacggcgcgctggccggcctgaacaaggcagaa
accgccgccaagttcggcgacgagcaggtgctggtgtggcgccgcagctatgacacgccg
ccgcccgcactggagcccaccgatccgcgtgcctcgtacgacgatccgcgctacgccaat
gtgccgcgcaacgagatcccactgaccgagtgcctgaaggacaccgtggcccgcgtgatg
ccgctgtggaacgaatccatcgcccccgacatccaatccggcaagcgcgtggtcattgcc
gcccatggcaacagcatccgcgcgctggtgaaatacctggaccagatctcggatgacgat
atcgtcggactcaatatccccaacggcaccccgctcgtctatgagctggacgccgacctg
cgccccctgcgccactactacctgggtgaccaggacgccatcgccgcctcgctggcggcc
gtggccagccagggcaaggcacgctga

DBGET integrated database retrieval system