KEGG   Cupriavidus necator N-1: CNE_1c09900Help
Entry
CNE_1c09900       CDS       T01564                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase TpiA
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cnc  Cupriavidus necator N-1
Pathway
cnc00010  Glycolysis / Gluconeogenesis
cnc00051  Fructose and mannose metabolism
cnc00562  Inositol phosphate metabolism
cnc00710  Carbon fixation in photosynthetic organisms
cnc01100  Metabolic pathways
cnc01110  Biosynthesis of secondary metabolites
cnc01120  Microbial metabolism in diverse environments
cnc01130  Biosynthesis of antibiotics
cnc01200  Carbon metabolism
cnc01230  Biosynthesis of amino acids
Module
cnc_M00002  Glycolysis, core module involving three-carbon compounds
cnc_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cnc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CNE_1c09900 (tpiA)
   00051 Fructose and mannose metabolism
    CNE_1c09900 (tpiA)
   00562 Inositol phosphate metabolism
    CNE_1c09900 (tpiA)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    CNE_1c09900 (tpiA)
Enzymes [BR:cnc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     CNE_1c09900 (tpiA)
Exosome [BR:cnc04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CNE_1c09900 (tpiA)
  Exosomal proteins of bladder cancer cells
   CNE_1c09900 (tpiA)
  Exosomal proteins of melanoma cells
   CNE_1c09900 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AEI76347
UniProt: G0EZP2
Position
1:1016049..1016786
Genome map
AA seq 245 aa AA seqDB search
MRQKLVIGNWKMHGSLAANAALLEGIKAGAAKATLAVCAPFPYLAQCQALLNGSQVAWGA
QDVSAEARGAFTGEVAASMVGEFGCTYVLVGHSERRTYHGETDQTVAAKALRALEFGIVP
VVCVGETLAQREAGETEAVVGRQLQAVLDALTVEQLSRVVLAYEPVWAIGTGKTATSEQA
QAVHAFLRGQVVARDAGVAERMAILYGGSVKPDNAAELFSMTDIDGGLIGGASLKSEDFL
AIGNA
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
gtgagacaaaagctcgtcatcggcaattggaagatgcacggcagcctggctgcaaacgcg
gcgctgctggagggtatcaaggctggcgcggccaaggcgacgctggcggtctgcgcgccg
ttcccctatcttgcacaatgccaggcgttgctgaatggctcgcaggtggcctggggcgca
caagatgtgtcggcggaggcgcgtggcgccttcaccggtgaagtcgcggcatcgatggtc
ggtgaatttggttgcacttatgtgctggtcggccactcggagcgccgcacctatcatggc
gaaaccgaccagaccgtcgcggccaaggcgctgcgcgcgctggaattcggcatcgtcccg
gtggtctgcgtgggtgaaacgctggcccagcgcgaggcgggcgaaaccgaggcggtggtc
ggcaggcaactgcaggccgtgctggacgcgctgacggtggagcagctgagccgcgtggtg
ctggcctatgagccggtctgggcgatcggcaccggcaagaccgccaccagcgaacaggcg
caggcggtgcacgcgttcctgcgcggccaggttgttgcgcgcgatgcgggcgtggccgag
cgcatggccatcctgtacggcggcagcgtcaagccggacaatgcggccgaactgttttcc
atgaccgatatcgacgggggcctgattggcggcgcctcgctgaagtcggaagattttctc
gcgatcggcaacgcctga

DBGET integrated database retrieval system