KEGG   Cupriavidus necator N-1: CNE_1c17870Help
Entry
CNE_1c17870       CDS       T01564                                 

Definition
(GenBank) acetaldehyde dehydrogenase
  KO
K04073  acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
cnc  Cupriavidus necator N-1
Pathway
cnc00360  Phenylalanine metabolism
cnc00362  Benzoate degradation
cnc00620  Pyruvate metabolism
cnc00621  Dioxin degradation
cnc00622  Xylene degradation
cnc00650  Butanoate metabolism
cnc01100  Metabolic pathways
cnc01120  Microbial metabolism in diverse environments
cnc01220  Degradation of aromatic compounds
Module
cnc_M00545  Trans-cinnamate degradation, trans-cinnamate => acetyl-CoA
cnc_M00569  Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA
Brite
KEGG Orthology (KO) [BR:cnc00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    CNE_1c17870
   00650 Butanoate metabolism
    CNE_1c17870
  Amino acid metabolism
   00360 Phenylalanine metabolism
    CNE_1c17870
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CNE_1c17870
   00622 Xylene degradation
    CNE_1c17870
   00621 Dioxin degradation
    CNE_1c17870
Enzymes [BR:cnc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     CNE_1c17870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh GFO_IDH_MocA F420_oxidored NAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AEI77127
UniProt: G0EWD3
Position
1:1844789..1845757
Genome map
AA seq 322 aa AA seqDB search
MTSRKLKAAIIGSGNIGTDLMIKILRHGRHLEIAAMVGIDPASDGLARAARLGVATTHEG
AEGLIRLPVFDDIDFVFDATSAGAHVKNDALLRERKPGLRMIDLTPAAIGPYCVPVVNLD
AHLEASNVNMVTCGGQATIPIVAAVSRVAKVHYAEIVASISSKSAGPGTRANIDEFTETT
SKAIETVGGAARGKAIIVLNPAEPPLMMRDTVYTLSELADRDKIEASIEEMVRAVHAYVP
GYRLKQTVQFDEIPASAPLNIAGLGRFSGLKTSAFIEVEGAAHYLPAYAGNLDIMTSAAL
ATAERMAQSLLSAKETTAGALA
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgacttccaggaaactcaaggcagcgatcattggctcgggcaatatcggaaccgacctg
atgatcaagatcctgcgccacggcaggcatctggagatagcggcaatggtcggcatcgat
ccggcctccgacggactggcccgcgccgcgcgcctgggcgtcgctaccacgcacgaaggc
gccgaagggctgatccgcctgccggtcttcgatgatatcgactttgtgttcgatgccacc
tccgccggcgcgcatgtgaagaacgatgcgctgctgcgcgagcgcaagcctggcctgcgc
atgatcgatctgacgcccgccgcgatcgggccgtattgcgtgccggtggtcaacctcgat
gcgcatctggaggcgtccaacgtcaacatggtcacctgcggcggccaggccacgatcccc
atcgtggccgcggtctcgcgcgtggcgaaggtccactacgcggagatcgtcgcgtcgatc
agcagcaagtccgccggcccgggcacacgcgcaaacatcgatgagttcaccgagactacc
tccaaagcgatcgaaaccgttggcggtgccgcccggggcaaggccatcatcgtgctgaat
cccgccgagccgccgctgatgatgcgggacacggtgtacacgctgtcggaactcgccgac
cgcgacaagattgaggcatccatcgaagagatggtgcgcgcggtccatgcctatgtgccc
ggctaccgtctcaagcagaccgtgcagttcgacgagattccggccagcgcaccgctgaac
attgctggcctgggccgtttcagcggcctgaagacttcggcctttatcgaagtggaaggc
gccgcccattacctgcctgcctacgccggcaacctcgacatcatgacttccgccgccctg
gcgaccgccgaacggatggcgcaatcgctgctgagcgccaaagagaccaccgcaggagcc
ctcgcatga

DBGET integrated database retrieval system