KEGG   Cupriavidus necator N-1: CNE_1c26940Help
Entry
CNE_1c26940       CDS       T01564                                 

Definition
(GenBank) hypothetical protein
Organism
cnc  Cupriavidus necator N-1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF72
Motif
Other DBs
NCBI-ProteinID: AEI78009
UniProt: G0ET03
Position
1:2790119..2791198
Genome map
AA seq 359 aa AA seqDB search
MTEDLFGGLPLPTPPAPPERPASHPGAAVPPAPSGKPARGKSVQPAQADEALRALAAKLP
SNLYFGTSSWAYPGWNGLVYDGEYGDSLLSRKGLAAYSRHPLLRAAGIDRGFYGPIPLAD
YLSYAAQVPDGFRFLVKAPASVCDAWLRGPDGAGRLANAAFLDAEIAVRDFIVPATSGLG
SKCGPLLFQLSPMGPLADSAMFLERLDAFLGALPALDPSITPHACYTVELRDPALLTPRY
IRLLRRRGVRFCLSARDRLPPVPRQAAAQALMDEEAPGPLVLRWMLHGGRPYAYAEKLYA
PFDRIVDDDPDTRHAIADVVARTLRAGQPAIVIVSNNAEGCAPLSCVRLAEAIIARLAR
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
ttgactgaagacctctttggcgggctgcccctgcccaccccacctgcccctccggaacgg
cccgcctcccacccgggcgcggccgtcccgcccgctccctccggcaaacccgcgcgcggc
aagagcgtgcaacccgcacaggcggacgaagccctgcgcgcgctcgccgcgaagctgcca
tcgaacctgtacttcggcacgtcctcctgggcctaccccggctggaacgggctggtctat
gacggcgagtacggcgacagcctgctgtcgcgcaagggcctggccgcgtattcgcgccat
ccgctgctgcgcgccgccggcatcgaccgcggcttctacgggccgatcccgctggcggac
tacctgtcctacgccgcgcaggtccccgatggcttccgcttcctggtcaaggcgcccgcc
agcgtctgcgatgcctggctgcgcggccccgacggcgccggccggctggccaatgccgcc
ttcctggatgcggagatcgcggtgcgcgacttcatcgtgcccgccaccagcgggctgggc
agcaaatgcgggccgctgctgttccagctgtcgccgatggggccgctggccgacagcgcc
atgttcctggaacggctcgacgctttcctgggcgcgctgccggcgctcgacccgtcgatc
accccgcatgcgtgctacacggttgagctgcgcgacccggcactgctgacaccacgctac
atccggctgctgcgccgccgcggcgtgcgcttctgcctgtcggcacgcgaccgcctgccg
ccggtgccgcgccaggccgcggcgcaggcgctgatggacgaggaagcgccgggtccgctg
gtgctgcgctggatgctgcatgggggccggccctacgcctacgcggaaaagctgtacgca
cccttcgaccgcatcgtcgacgacgaccccgacacccgccatgccatcgccgatgtggtg
gcgcgcacgctgcgcgcggggcagcctgccatcgtcattgtcagcaacaacgccgagggc
tgcgcgccactgagttgcgtgcggctggccgaggcgatcattgcgaggctggcgcggtga

DBGET integrated database retrieval system