KEGG   Cupriavidus necator N-1: CNE_1c26970Help
Entry
CNE_1c26970       CDS       T01564                                 

Gene name
fadH1
Definition
(GenBank) 2,4-dienoyl-CoA reductase FadH
  KO
K13774  citronellol/citronellal dehydrogenase
Organism
cnc  Cupriavidus necator N-1
Pathway
cnc00281  Geraniol degradation
Brite
KEGG Orthology (KO) [BR:cnc00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00281 Geraniol degradation
    CNE_1c26970 (fadH1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase Polysacc_synt_2 GDP_Man_Dehyd Shikimate_DH
Motif
Other DBs
NCBI-ProteinID: AEI78012
UniProt: G0ET06
Position
1:2794544..2795440
Genome map
AA seq 298 aa AA seqDB search
MSYRSVFHRGLFAGRTVLVTGAGSGIGRCTAHELASLGARLALAGRKLEKLEQVKAEIIA
VEPEAASRITLHSCDIRDEAQVRETVAAVLAAHGAINGLFNNAGGQFPSPLRDISLKGWE
AVVRNNLTGGFLVARECFTQWMEANGGAIVNIIADMWNGMPGMGHSGAARAGMLSFTETA
ACEWAAAGVRVNAVAPGWIASSGFDTYPPEFQAKIRQLARKVPLQRLGTEAEVSAAVVFL
LSPAAAFITGSTIRVDGGVPNAKHTWPQPEHQRSEPFNGFPLYTLPQCLTPATESETP
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgtcctatcgttccgtattccatcgcggcctgttcgccggccgcacggtgctggtaacc
ggcgccggcagcggcatcggccgttgcacggcacacgaactggccagtcttggcgcgcgc
cttgcgctggccggccgcaagctcgagaagcttgagcaggtgaaggccgagatcatcgcc
gtcgagccggaagccgccagccgcatcacgctgcacagctgcgacatccgcgacgaggcc
caggtgcgcgagaccgtagccgccgtgctggccgcgcacggcgccatcaacggcctcttc
aacaacgccggcgggcagtttccgtcgccgctgcgcgatatcagcctgaagggctgggaa
gccgtggtgcgcaacaaccttactgggggcttcctggtggcacgtgaatgcttcacgcaa
tggatggaagccaacggcggcgccatcgtcaacatcattgccgatatgtggaatggcatg
ccgggcatgggccattcgggcgccgcgcgcgccggcatgttgtctttcaccgagaccgcc
gcctgcgaatgggccgctgcaggagtgcgcgtgaacgcggtggcgcccggctggatcgct
tccagcggctttgacacctacccgccggaattccaggccaagatccgccagctggcgcgc
aaggtgccgctgcagcgcctgggcaccgaagccgaagtctcagcggccgtggtgttcctg
ctctcgccggcggcggccttcatcaccggctcgaccatccgtgtcgacggcggcgtgccc
aacgccaagcacacctggccgcagcccgagcaccagcgctcggagcctttcaacggcttc
ccgctctacacgctgccgcagtgcctgacgccagccaccgaatcagagacaccatga

DBGET integrated database retrieval system