KEGG   Cupriavidus necator N-1: CNE_1c26990Help
Entry
CNE_1c26990       CDS       T01564                                 

Definition
(GenBank) hypothetical protein UPF0065
Organism
cnc  Cupriavidus necator N-1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TctC
Motif
Other DBs
NCBI-ProteinID: AEI78014
UniProt: G0ET08
Position
1:complement(2796636..2797646)
Genome map
AA seq 336 aa AA seqDB search
MTRPKPDARIRRQLCLGLFAGLAAGSLAGPLPAMAQGDAYPNRPIRVVVPYTPGGVSDAV
TRLVMQKLAQRIGQPVVVENRPGANGMIGSENVARSAPDGYSLLVVVAGHAINPSLYPKM
SYDPLKDLTGVSMIGRIPLLLVSSAQLPPTTVKELVGWGKANPAKMTFASSGNGSGAHLA
GELFAQSVGMQMTHVPYKGISPALPDLFSGQVAIIFDSVQTMMPQVKAGKVRALAISSPT
RWPAAPEVPTMAEAGYPGVTAGSWIGLIAPAMTPPAVQAKLAREMEAVLQQPDVRARLID
YGIDPVGGKPEQFQAFIKAEAVRWGEVVKKSGLRLE
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgacccgacccaagcccgacgcgcgcatccggcgccagctatgcctgggcctgttcgca
ggactggccgcaggcagcctcgccggccccttgcccgccatggcgcagggcgacgcctat
cccaaccgcccgatccgcgtggtcgtgccatacacgcctggtggtgtgtcagacgccgtg
acgcggctggtgatgcagaagttggcgcaacgcatcggccagccggtggtggtggagaac
cgccccggcgccaacggcatgatcggctcggagaacgtcgccaggtccgcgccggacggc
tattcgctgctggtggtggtggccgggcacgccatcaatcccagcctgtatccgaagatg
agctatgacccgctcaaggacctcaccggcgtcagcatgatcgggcggattccgctgctg
ctggtctccagcgcgcagctgccgccgaccacggtgaaagagctggtgggctggggcaag
gccaatcccgcgaagatgacctttgcctccagcggcaatggctccggcgcgcacttggcg
ggcgagctgttcgcgcagtcggtcggcatgcagatgacgcacgtgccttacaagggcatt
tcgccggcgctgcctgatttgttctcggggcaggttgccatcatcttcgattcggtgcag
accatgatgccgcaggtgaaggcaggcaaggtgcgcgcgctggcgatctccagcccgacg
cgctggccggccgcgccggaggtgccgaccatggccgaggccggttatccgggcgtcacg
gcaggcagctggatcggcctgatcgcaccggcgatgacgccgccggcggtgcaggcaaag
ctggcccgggaaatggaagcggtcctgcagcagcccgacgtacgggcaaggctgatcgac
tatgggattgatccggtcggcggcaagccggagcagttccaggcgttcatcaaggccgaa
gcggtgcgatggggtgaagtggtgaagaagagcggactgcggctggagtaa

DBGET integrated database retrieval system