KEGG   Cupriavidus necator N-1: CNE_1c27010Help
Entry
CNE_1c27010       CDS       T01564                                 

Gene name
accA4
Definition
(GenBank) acetyl-/propionyl-coenzyme A carboxylase alpha chain
  KO
K13777  geranyl-CoA carboxylase alpha subunit [EC:6.4.1.5]
Organism
cnc  Cupriavidus necator N-1
Pathway
cnc00281  Geraniol degradation
Brite
KEGG Orthology (KO) [BR:cnc00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00281 Geraniol degradation
    CNE_1c27010 (accA4)
Enzymes [BR:cnc01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.5  geranoyl-CoA carboxylase
     CNE_1c27010 (accA4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C Biotin_lipoyl ATPgrasp_Ter Biotin_lipoyl_2 Dala_Dala_lig_C ATP-grasp HlyD_3 DUF3182 RnfC_N ATP-grasp_3 GCV_H NQRA
Motif
Other DBs
NCBI-ProteinID: AEI78016
UniProt: G0ET10
Position
1:complement(2799502..2801505)
Genome map
AA seq 667 aa AA seqDB search
MSATRRSFHTLLVANRGEIAVRIMRTARRLGLATVAVYSEADRHSPHLACADRAVCIGAA
APRESYLNIAAIVEAARASGADAVHPGYGFLAENAAFAEAVTAAGLVFVGPPAAAIRAMG
NKAEAKRLMLAADMPCVPGYQGAAQDDATLLAEAGSIGFPLMVKAAAGGGGRGMRLVRDA
AALPAALSSARSEAAAAFGSDELILERAVIAPRHVEIQVFADTHGNVIHLGERDCSVQRR
HQKVIEEAPSPAVGPVLRARMGEAAVRAAKAIGYVGAGTIEFLLDAEGSFYFMEMNTRLQ
VEHAVTEAITGFDLVEWQLRVAAGEPLPVTQDQVRLNGHAIEVRLTAEDVPAGFLPQGGP
LLRWRPPAAGRDVRVDHALEEGGAIPTHYDSMVAKLVAHGADREEARRKLLRSVQDCTLL
GVPTNQGFLAACLAHPAFAGNDVHTGFVDTHMQAALQAPVPPVHVTASAALAASGLLGGS
GKPATLARAASSVVLNAAGKAWEAFLRVSADGWRVSLRQRGEDHPPVECRLRVLRADAAN
GTALVECDGVAYPLVFAAEKHALHLFQSGRAWQFPLHDPRRRRDAGDADGVLQAPLTARI
VAVNVAEGDHVEAGQALVVLEAMKMEHTILAPFAGVVAEVPARAGGQASAGSLLARVEAD
VAAKEEA
NT seq 2004 nt NT seq  +upstreamnt  +downstreamnt
atgtctgctacccgccgatccttccatacgctgctcgttgccaatcgcggcgagatcgcg
gtgcgcatcatgcgcaccgcccgccgcctcgggctggctaccgtcgccgtgtattccgaa
gcggaccgccacagcccgcaccttgcctgcgccgaccgcgccgtgtgcatcggcgccgcc
gcgccgcgcgagtcgtacctgaacattgccgccatcgtcgaagcagcccgcgccagcggt
gccgatgccgtgcaccccggctatggcttcctggccgagaacgccgcctttgccgaggcg
gtcaccgccgccggcctggtcttcgtcggcccgcccgccgcggcgatccgcgccatgggc
aacaaggccgaagccaagcggctgatgctggctgccgacatgccctgcgtgcccggctat
cagggggccgcgcaggatgacgccacgctgctggccgaggccgggtccatcggcttcccc
ctgatggtcaaggctgcggcgggcggcggcgggcgcggcatgcggctggtgcgcgacgcg
gcggcgctgcccgcggcgctgtcgagcgcacgctccgaggcggcggcagcgttcggctca
gacgaactgatcctggagcgcgccgtgatcgcgccgcgccacgtggagatccaggtcttt
gccgatacccacggcaatgtcatccatctcggcgagcgcgactgctccgtgcagcgccgc
caccagaaggtcatcgaggaagcgccgtcgcccgcggtcggcccggtgctgcgtgcgcgc
atgggcgaggccgccgtgcgcgcggccaaggccatcggctacgtcggcgccggcaccata
gagttcctgctcgatgccgagggcagcttctacttcatggagatgaacacccggctgcag
gtcgaacacgccgtgaccgaggccatcaccggcttcgacctggtcgaatggcaactgcgc
gtggcggcgggcgagccgctgccggtcacgcaggaccaggtccggctcaacgggcatgcc
atcgaagtgcgactcaccgccgaggacgtgccggccggcttcctgccgcagggcgggccg
ctgctgcgctggcgcccgcccgccgctggtcgcgatgtacgtgtggaccatgcgctggaa
gagggcggtgccatccccacccactatgactcgatggtcgccaagctggtcgcgcatggc
gccgaccgcgaagaggcgcgccgcaagctgctgcgatcggtgcaggactgcacgctgctg
ggcgtgcccaccaaccaggggttcctggccgcgtgcctggcgcacccggcgttcgccggc
aatgacgtgcatacgggctttgtcgacacccatatgcaggcggcgctgcaggccccggtg
cctccggtgcatgtgacggcaagcgccgcgctggccgcatcggggctgctgggcggcagc
ggcaagccggccacgcttgcgcgtgcggcttccagcgtggtgctgaatgcggccggcaag
gcctgggaagcgttcctgcgcgtgtccgccgacggctggcgcgtgagcctgcgccagcgc
ggtgaagaccacccgccggtggaatgcaggctgcgcgtgctgcgtgccgatgccgccaac
ggcacggccctggtcgaatgcgacggcgtggcctatccgctggtgttcgccgccgaaaag
cacgcgctgcacctgttccagtccggccgcgcctggcagttcccgctgcacgatccgcgc
cgccgccgcgatgcgggcgacgccgacggcgtgctgcaggcgccgctgacggcccgcatc
gtcgcggtcaatgtggccgagggcgaccacgtggaagcgggccaggcgctggtggtgctg
gaggccatgaagatggagcacaccattttggcgccgtttgccggcgtggtggcggaggtg
cccgcgcgcgccggtgggcaggccagtgccggttcgttgctggcgcgggtggaggccgat
gtggccgcaaaggaagaagcatga

DBGET integrated database retrieval system