KEGG   Cupriavidus necator N-1: CNE_1c27020Help
Entry
CNE_1c27020       CDS       T01564                                 

Definition
(GenBank) enoyl-CoA hydratase/isomerase
  KO
K13779  isohexenylglutaconyl-CoA hydratase [EC:4.2.1.57]
Organism
cnc  Cupriavidus necator N-1
Pathway
cnc00281  Geraniol degradation
Brite
KEGG Orthology (KO) [BR:cnc00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00281 Geraniol degradation
    CNE_1c27020
Enzymes [BR:cnc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.57  isohexenylglutaconyl-CoA hydratase
     CNE_1c27020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: AEI78017
UniProt: G0ET11
Position
1:complement(2801547..2802392)
Genome map
AA seq 281 aa AA seqDB search
MPDSSCNDAVIVRRAGGVLFATLNIPATRNALAPEVVAALAAAVAQAEADPEVRALVLRG
SGGSFSAGGNVGSFQSRLDADASQEDPVATRNRQFGYFMERLSVLPVPVIAAVEGAAMGG
GMGLACAADIVLATRDARFALSETTLGIVAAQIAPFVVQKLGAAATRRLGLTGERVSGDA
AVAIGLVDQLAADSAELDALIAEWLTRIGRCGPNANRVFKALVGRCGHEPPGPLLDEASR
QFAQCMRREGAEGVAAFRDKRDAAWTVRFDADTVRAAQSTG
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgcctgacagctcatgcaacgatgccgtgatcgtgcgccgcgccggcggcgtactgttt
gccaccctcaacattcctgccacccgcaacgcattggcgcccgaagtggtggccgcgctg
gccgccgccgtggcgcaggccgaagccgacccggaagtccgcgcgctggtgctgcgcggc
tccggcggcagcttcagcgcaggcggcaacgtgggcagcttccagtcccggctcgatgcc
gacgccagccaggaagacccggtcgccacgcgcaaccgccagttcggctacttcatggag
cgcctgagcgtgctgccggtgccggtgatcgccgcggttgagggcgcggccatgggcggc
ggcatgggcctggcctgcgcggccgacatcgtgctggctacgcgcgatgcgcgctttgcg
ttgtcggagaccacgctgggcattgtcgccgcgcagatcgctccctttgtggtgcaaaag
ctgggcgctgccgccacgcgccgcctgggcctgaccggcgagcgcgtcagcggcgatgca
gcggtagccatcggcctggtcgaccagctcgcggccgacagcgcggagctggacgccctg
atagccgagtggctgacgcgcatcggccgttgcggcccgaatgccaaccgcgtgttcaag
gcactggtcggccgctgcggccacgagccgccaggcccgctgctggacgaggcctcgcgc
cagtttgcgcaatgcatgcggcgcgagggcgccgaaggcgtggcggcattccgcgacaag
cgcgatgccgcctggaccgttcgcttcgatgccgacacggtgcgcgccgcgcagtcgacc
ggctga

DBGET integrated database retrieval system