KEGG   Cupriavidus necator N-1: CNE_1c27040Help
Entry
CNE_1c27040       CDS       T01564                                 

Gene name
pccB
Definition
(GenBank) propionyl-CoA carboxylase beta subunit
  KO
K13778  geranyl-CoA carboxylase beta subunit [EC:6.4.1.5]
Organism
cnc  Cupriavidus necator N-1
Pathway
cnc00281  Geraniol degradation
Brite
KEGG Orthology (KO) [BR:cnc00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00281 Geraniol degradation
    CNE_1c27040 (pccB)
Enzymes [BR:cnc01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.5  geranoyl-CoA carboxylase
     CNE_1c27040 (pccB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Carboxyl_trans ECH_1
Motif
Other DBs
NCBI-ProteinID: AEI78019
UniProt: G0ET13
Position
1:complement(2803641..2805260)
Genome map
AA seq 539 aa AA seqDB search
MIPIDSRIDSSSDAFASQRAGMQALIDRLHGLEQRAVAASERARPTFARRGALLPRERIG
RLLDAGAPFLPMATLAGFGMDDPDPETSIPGGSLVAGIGFVCGVRCMVLATDSGIDAGAM
TEAGNMKLMRCQEIALENRLPFIHLVESAGANLRKYRVDKFVRGGALFYNLARLSAAGLP
VITVVHGSSTAGGAYMPGLSDYVVMVRNRARAFLAGPPLLKAATGEIATDEELGGADLHA
TVSGLAEYLAEDDEHAIATARDIVASLDWPTVATEPAQLARPPRLDPSELDGVMTLDMKR
PVDMREVIARIVDDSAWLPFKPDYGPGTVCGHARIEGNTVGFITNNGPIDPAGATKAAQF
IQLCNQSDTPIVFLQNTTGFIVGRASEEAGMIKHGAKMIQALSNSTVPQITLYCGASFGA
GNFGMCGRGFRPRFCFSWPNARTAVMGGEQAAMTLEIVARQQAARKGVPVDEAQLASQTA
DIVANFERQASAFVTSGLLLDDGVIDPRDTRAVLAFVLATAREASLRKPHAIQFGVGRF
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgattcccatcgactcacgcatcgactcatcttccgacgcctttgccagccagcgcgcc
ggcatgcaggccctgatcgaccgcctccatggcctcgaacagcgtgccgtggccgcctcg
gagcgcgcccggcccacctttgccagacgcggggcgctgctgccgcgcgagcgcatcggc
cgcctgctggacgcaggcgcgccgttcttgccgatggccacgctggccggcttcggcatg
gacgatcccgaccccgagacctccatccccggcggttcgctggtggccggcatcggtttc
gtctgcggcgtgcgctgcatggtgctggccacggattccggcatcgacgccggtgccatg
accgaggccggcaacatgaagctgatgcgctgccaggagatcgcgctggaaaaccggctg
ccattcattcacctggtggaatcggccggcgccaacctgcgcaagtaccgcgtggacaag
ttcgtccgcggcggcgcgctgttttacaacctggctcgcctgtccgcggccgggctgccg
gtgatcacggtcgtgcatggctcgtccacggcgggcggcgcctacatgccggggctgtcc
gactacgtggtgatggtgcgcaatcgcgcgcgcgccttcctggcggggccgccgctgctg
aaggccgccaccggcgaaatcgccacggatgaggagctgggcggcgccgacctgcatgcc
acggtcagcggcctggccgaatacctggccgaggacgacgagcacgctattgccaccgca
cgcgacatcgtcgccagcctggactggccgaccgtggcgacggagcccgcgcagctcgcc
cgccctccgcggctcgatccgtcggagctggacggcgtgatgacgctcgacatgaagcgc
ccggtggacatgcgcgaagtgatcgcgcgcattgtcgacgactccgcctggctgccgttc
aagcccgactatggtcccggcacggtgtgcggccacgcccgcatcgaaggcaatacggtc
ggcttcatcaccaacaacggtcctatcgacccggccggcgccaccaaggccgcgcagttc
atccagctatgcaatcagtcggacacgccgatcgtgttcctgcagaacaccaccggcttt
atcgtcggccgtgcctcggaagaggccggcatgatcaagcatggcgccaagatgatccag
gcgctgtcgaactcgacggtgccgcagatcacactgtactgcggggcctcgttcggggcg
ggcaacttcggcatgtgcggacggggcttccggccgcgcttctgcttctcgtggccgaac
gcgcgcaccgccgtgatgggcggcgagcaggccgccatgacgcttgagatcgtggcgcgc
cagcaggccgcgcgcaagggcgtgccggtagatgaggcgcagcttgccagccagaccgcc
gatatcgttgccaacttcgagcgccaggccagcgccttcgtcaccagcgggctgctgctg
gacgacggcgtcatcgacccgcgcgacacgcgcgccgtgctggccttcgtgctggccacc
gcgcgcgaggccagcctgcgcaagccgcatgcgatccagtttggtgtcgggcgcttttga

DBGET integrated database retrieval system