KEGG   Cupriavidus necator N-1: CNE_1c27070Help
Entry
CNE_1c27070       CDS       T01564                                 

Gene name
lcfB5
Definition
(GenBank) long-chain-fatty-acid--CoA ligase LcfB
  KO
K00666  fatty-acyl-CoA synthase [EC:6.2.1.-]
Organism
cnc  Cupriavidus necator N-1
Brite
Enzymes [BR:cnc01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.-  
     CNE_1c27070 (lcfB5)
Lipid biosynthesis proteins [BR:cnc01004]
 Acyl-CoA synthetase
  Unknown
   CNE_1c27070 (lcfB5)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: AEI78022
UniProt: G0ET16
Position
1:complement(2806824..2808359)
Genome map
AA seq 511 aa AA seqDB search
MSAARRAMRAGAAGLGALPAMLHGHAAAAPGRPALHYLGRTFTYGKLWRRVERASAHLAA
TWGIRAGERVGTLCLNHELQLVLLFACARVGAMFVPLNYRLAPAELRTIAAHTQLAALFH
DERHAGLAQEAGGGCQVAHLDRLVDHPAPFGVPHPPVPDEAPLLLAYTSGTTGKPKGAVH
TQAGLLANARASWWAHGMTADDHVLSVLPMFHVGGLCIQTLPALLAGAQVTLHDRFAPDA
WLGAVAQARPSLSLMVPATLRAVLEHPGWPGADLSALRGVMAGSSTIPLSYIEAFHARGV
PLGQVYGATETGPVSVVLKLQDALARPGYAGWPQPEAQVRLAGPDGAEVAQGAVGELWVR
GANVMAGYWNQPDNGLADGWFHSGDLAHRDAGGCIEVVGRSKDMIISGGENIYPAEIENV
LVGLPGVQECAVVGVADARWGEVPVAVIVPAPGAPRDALGAEPLRELLATRIARFKLPRE
VVLLDDLPRSALGKVLKPQLRAMLEAQRQPG
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccgcccgtcgcgccatgcgtgcgggcgccgccgggctgggcgcgctgccggcc
atgctgcatggccatgccgccgcggcgccggggcggccggcgttgcactacctgggccgc
accttcacctacggcaagctgtggcggcgcgtcgagcgtgccagcgcccacctggcagcg
acgtggggcatccgcgcgggcgagcgcgtcggcacgctgtgcctgaaccacgaactgcag
ctggtgctgctgttcgcctgcgcgcgtgtcggggcgatgttcgtgccgctgaactaccgg
ctggcgccggcggagctgcgtaccatcgccgcccacacgcagctggccgcgctgttccat
gacgagcgccatgcagggctggcgcaggaggctggcggcggctgccaggtcgcgcatctc
gaccggctggtcgaccatcccgcgccgttcggcgtgccccacccgccggtgccggacgag
gcgccgctgctgctcgcctacacctccggcaccaccggcaagcccaagggcgcggtgcat
acgcaggccgggctgctggccaatgcgcgcgccagctggtgggcgcatggcatgaccgcg
gacgatcacgtgctgtcggtgctgccgatgttccacgtcggcgggctgtgcatccagacg
ctgccggcgctgctggccggggcgcaagtcacgctgcacgaccgctttgcgccggatgcc
tggcttggcgcggtcgcgcaggcgcggccgagcctgtcgctgatggtgccggccacgttg
cgcgcggtgctggagcatcccggctggcccggggccgacctgtcggcgctgcgcggcgtg
atggcaggttcgtcgaccatcccgctgtcgtatatcgaggcctttcatgcgcgcggtgtg
ccgctggggcaggtctatggcgcgaccgagaccggtccggtgtcggtggtgctgaagctg
caggatgcgctggcccggcctggctatgccggctggccgcagccggaggcgcaagtccgg
ctggccggcccggacggtgccgaggtggcgcagggcgcagtcggtgaactctgggtgcgc
ggcgccaacgtgatggcgggctactggaaccagcctgataacggcctggccgacggctgg
ttccattccggcgacctcgcgcaccgcgatgccggcggctgcatcgaagtcgtcggccgc
agcaaggacatgatcatctcgggcggcgagaacatctatcccgccgagatcgagaacgtg
ctggtcggcctgcccggggtgcaggagtgcgcggtcgtcggcgtggccgacgcgcgctgg
ggcgaggtgccggtggcggtgatcgtgcccgcgccgggcgcgccgcgcgacgcgctgggg
gcggagccgctgcgcgaactgctggctacgcgcattgcccgcttcaagctgccgcgcgag
gtggtgctgctggacgacctgccgcgcagcgcgctgggcaaggtgctcaagccgcaactg
cgcgcgatgctggaggcgcagcgccagcctggctga

DBGET integrated database retrieval system