KEGG   Cupriavidus necator N-1: CNE_1c27110Help
Entry
CNE_1c27110       CDS       T01564                                 

Gene name
ntaB1
Definition
(GenBank) nitrilotriacetate monooxygenase component B
Organism
cnc  Cupriavidus necator N-1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavin_Reduct
Motif
Other DBs
NCBI-ProteinID: AEI78026
UniProt: G0ET20
Position
1:2811746..2812303
Genome map
AA seq 185 aa AA seqDB search
MGMPEAQPQIASAAAPDFDAQHFRRTLSQFATGVTVITTRASAESVAAGAPPFIGITASS
FNSVSLDPPLVLWSMATRANSLPMFRDGTHYIINVLSASQLELCQRFATLKGDRFAGVDY
RLSATGLPILSNALAWFECHNRSRYDEGDHIIFVGEVERCGVLDGSDGPLVFQGGQFTTT
APLDL
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgggcatgcctgaggcccagccacagatcgccagcgccgccgcaccagatttcgatgcg
cagcacttccgccgcaccctgtcgcagttcgcgaccggggtgacggtgatcactacgcgc
gccagcgccgagtctgtcgccgccggcgcgccgccgttcatcggcatcaccgccagttcg
ttcaattcggtgtcgctggatccgccgctggtgctgtggagcatggccacgcgcgccaac
agcctgccgatgtttcgcgacggcacgcactacatcatcaacgtgctgtcggcctcgcag
ctggagctgtgccagcgctttgccaccctcaagggcgaccgattcgccggcgtcgactac
cggctctcggccaccggcctgccgatcctgtccaatgcgctggcctggttcgaatgccac
aaccgcagccgctacgacgagggcgaccacatcatcttcgtgggcgaagtcgagcgctgc
ggcgtgctcgatggcagcgacggcccgctggtattccagggtggccagttcaccaccacc
gcccccctcgacctctga

DBGET integrated database retrieval system