KEGG   Cupriavidus necator N-1: CNE_1c27160Help
Entry
CNE_1c27160       CDS       T01564                                 

Gene name
kynA
Definition
(GenBank) tryptophan 2,3-dioxygenase KynA
  KO
K00453  tryptophan 2,3-dioxygenase [EC:1.13.11.11]
Organism
cnc  Cupriavidus necator N-1
Pathway
cnc00380  Tryptophan metabolism
cnc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cnc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    CNE_1c27160 (kynA)
Enzymes [BR:cnc01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.11  tryptophan 2,3-dioxygenase
     CNE_1c27160 (kynA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_dioxygenase Hs1pro-1_C
Motif
Other DBs
NCBI-ProteinID: AEI78031
UniProt: G0ET25
Position
1:2815382..2816269
Genome map
AA seq 295 aa AA seqDB search
MSEFKGCPFSGAAGTAGQAAPQGDNWHGAQMDFAKDMSYGDYLGLDQILNAQHPLSPDHN
EMLFIVQHQTTELWMKLMLHELRAARESVKTDSLPPAFKMLTRVSRIMDQLVQAWNVLAT
MTPPEYSAMRPYLGMSSGFQSYQYREIEFILGNKNAAMLKPHAHRPEHLALVETALKTPS
LYDEAIRLMARRGFAIDADCVERDWTQPTAYNASVEAAWLEVYRNPGAHWELYELGEKFV
DLEDAFRQWRFRHVTTVERVIGFKRGTGGTEGVSYLRKMLDVVLFPELWKLRTDL
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaattcaagggatgccctttttccggcgcggccggcaccgcaggccaggctgcg
ccgcaaggtgacaactggcacggcgcgcagatggatttcgccaaggacatgagctatggc
gactatctcggcctggaccagatcctgaacgcgcagcacccgctgtcgccggaccacaac
gagatgttgtttatcgtgcagcaccagaccaccgagctgtggatgaagctgatgctgcac
gagctgcgcgccgcgcgcgaatcggtcaagaccgacagcctgccgccggcgttcaagatg
ctgacgcgggtgtcgcgcatcatggaccagctggtgcaggcgtggaacgtgctggcgacg
atgacgccgccggaatactcggcgatgcggccctacctgggcatgtcgtcaggcttccag
tcgtatcagtaccgcgagatcgagttcatcctcggcaacaagaacgctgccatgctgaag
ccgcacgcgcaccggccggagcatttggcgctggtggaaacggcgctgaagacgccgtcg
ctgtatgacgaggcgatccggttgatggccaggcgtggttttgcgatcgatgcggactgc
gtcgaacgggactggacgcagcccaccgcgtataacgcgtcggtcgaggccgcctggctg
gaggtctatcgcaatcccggtgcgcactgggaactgtatgaactgggcgagaagtttgtc
gacctggaagatgcgttccggcaatggcgcttccggcatgtgaccacggttgagcgggtg
attggcttcaagcgtggtaccggcggcacggaaggcgtcagctatctgcgcaagatgctg
gatgtagtgttgtttccggaattgtggaagttgcgcacggacctgtaa

DBGET integrated database retrieval system