KEGG   Cupriavidus necator N-1: CNE_1c27200Help
Entry
CNE_1c27200       CDS       T01564                                 

Definition
(GenBank) hypothetical protein
Organism
cnc  Cupriavidus necator N-1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF883 ApoLp-III DUF4375 DUF812 YtxH
Motif
Other DBs
NCBI-ProteinID: AEI78035
UniProt: G0ET29
Position
1:2819590..2819916
Genome map
AA seq 108 aa AA seqDB search
MSESAQTEPTARKQEKLMSDVKTVLSDAEELLKQAASTTGEKAAELRERGMGLLKQAKEK
AQDLQDAVVTKSKAAARATDDYVHDHPWRAVGVAAGVGLLIGLLLNRK
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaatccgcacaaaccgaaccaaccgcccgcaaacaggagaaactgatgagcgat
gtcaagaccgttctgtccgacgccgaggaactgctgaagcaagccgcctcgaccaccggg
gaaaaggccgccgaactgcgcgagcgtggcatgggcctgctcaagcaagccaaggaaaag
gcccaggacctgcaagacgccgtcgtgaccaagagcaaggccgctgcacgcgccaccgac
gactacgtgcatgaccacccgtggcgcgccgtgggcgtggccgccggcgtaggcctgctg
atcggtctgctgctgaaccgcaagtaa

DBGET integrated database retrieval system