KEGG   Cupriavidus necator N-1: CNE_1c27260Help
Entry
CNE_1c27260       CDS       T01564                                 

Definition
(GenBank) hypothetical protein
Organism
cnc  Cupriavidus necator N-1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_17
Motif
Other DBs
NCBI-ProteinID: AEI78041
UniProt: G0ET35
Position
1:2827247..2827462
Genome map
AA seq 71 aa AA seqDB search
MKDITFNERLLTPVETSEMVGKSVAWLARKRWEGGGIPYRKIGRHVRYQLTDVLEWLNSQ
PRLISTSQLGK
NT seq 216 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagacatcacattcaatgagcgactacttacccccgtggaaacatctgaaatggtg
gggaaatccgttgcgtggcttgcacgcaagcgatgggaaggcggcggcattccctatcga
aaaattgggcggcatgttcgctaccaattgaccgacgttctcgaatggctcaactcacaa
ccccggctcatctccaccagccagctaggcaaatga

DBGET integrated database retrieval system