KEGG   Cupriavidus necator N-1: CNE_1c27300Help
Entry
CNE_1c27300       CDS       T01564                                 

Gene name
queC
Definition
(GenBank) 7-cyano-7-deazaguanine synthase QueC
  KO
K06920  7-cyano-7-deazaguanine synthase [EC:6.3.4.20]
Organism
cnc  Cupriavidus necator N-1
Pathway
cnc00790  Folate biosynthesis
cnc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cnc00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CNE_1c27300 (queC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cnc03016]
    CNE_1c27300 (queC)
Enzymes [BR:cnc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.20  7-cyano-7-deazaguanine synthase
     CNE_1c27300 (queC)
Transfer RNA biogenesis [BR:cnc03016]
 Prokaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    CNE_1c27300 (queC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: QueC Asn_synthase ThiI tRNA_Me_trans NAD_synthase Arginosuc_synth ATP_bind_3 PAPS_reduct
Motif
Other DBs
NCBI-ProteinID: AEI78044
UniProt: G0ET38
Position
1:complement(2831674..2832357)
Genome map
AA seq 227 aa AA seqDB search
MTQRAIVLLSGGLDSATVLAMARAQGFETYALSMRYGQRHSSELEAAKRVAAALGATRHE
IIDLDLRRFGGSALTDDTLAVPTDGASGGIPVTYVPARNTIMLSLALGWAEAVGGRDLFF
GANAVDYSGYPDCRPEYVAAYETLANLATKAGVEGDRFRVHAPIIDMTKGEIIRAGIALG
VDYSLTVSCYQADDDGRACGVCDSCRIRRAGFEAAGVPDPTRYQAAA
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgacccaacgcgccatcgtcctgctgtccggcggactcgactccgccaccgtactcgcc
atggcccgcgcccagggcttcgagacctatgcgctgtcgatgcgctatggccagcgccac
tcctctgaactggaagccgccaagcgcgtggcggccgcgctgggcgccacgcgccacgag
atcatcgacctggacctgcgccgcttcggcggctcggcgctgaccgacgacacgctcgcg
gtgccgaccgacggcgcttccggtggcatcccggtcacctacgtgccggcgcgcaacacc
atcatgctgtcgctggcgctcggctgggccgaggccgtcggcgggcgcgacctgttcttc
ggcgccaatgcggtcgactactccggttacccggactgccgcccggaatacgtcgcggcc
tatgaaacgctggccaacctcgccaccaaggccggggtcgagggcgaccgcttccgcgtg
catgcgcccatcatcgacatgaccaagggcgagatcatccgcgccggcatcgcgctgggg
gtggactacagcctgacggtgtcgtgctaccaggccgacgacgacggccgcgcctgcggc
gtgtgcgattcgtgccgcatccgccgggccggctttgaagccgccggtgtgcccgatccg
acccgctaccaggccgctgcctga

DBGET integrated database retrieval system