KEGG   Cupriavidus necator N-1: CNE_1c27330Help
Entry
CNE_1c27330       CDS       T01564                                 

Gene name
tolB
Definition
(GenBank) protein TolB
  KO
K03641  TolB protein
Organism
cnc  Cupriavidus necator N-1
Brite
KEGG Orthology (KO) [BR:cnc00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cnc02000]
    CNE_1c27330 (tolB)
Transporters [BR:cnc02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   CNE_1c27330 (tolB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PD40 TolB_N DPPIV_N Gmad1 DUF5050 eIF2A SGL
Motif
Other DBs
NCBI-ProteinID: AEI78047
UniProt: G0ET41
Position
1:complement(2833783..2835156)
Genome map
AA seq 457 aa AA seqDB search
MRKLWAPNWLSARRHNATQPESQRAIGPAPLAGRRALMAWLAAAMTMAAGAAHAQLNVEI
SGVGSSQIPVATANFQGEAQAPQNLTAIIRADLTRSGRLRNVDPGGATVAESANVDLGSW
KSRGADAFVAGSVTPAAGGKYEVRFRLYDTVKGQSLGGLAFTVNQSQLRVTAHKIADYIY
EKLLGERGVFATRLSYVSKVGGRYQLLISDSDGQNAQVALTSNEPIISPSWSPDGARVAY
VSFEAKKPVVYVHDLASGKRTLVSNQKGNNSAPSWSPDGQHLALALSRDGNTQVYQVNAD
GSGVRRLSRSSAIDTEPQYSPDGKSIYFTSDRGGAPQVYRMPASGEEGGGAQRVTFKGSY
NVSPRISPDGKYLAYISRTGGFKLQLQDLSNGDVTSLTDTANDEAPSFAANGKYILYATR
VGGRAVLAAVSTDGRTRQVLSLQSGDVREPSWGPFMQ
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgcgaaagctttgggcccccaactggctgtccgcgaggcggcacaacgcaacccaaccc
gaatcccaacgcgccatcggcccggcccccctggccggccgccgcgcgctgatggcctgg
ctggccgcggcgatgacgatggcagccggcgccgcgcacgcgcaactcaacgttgagatc
tccggggtcggttccagccagattccggttgcgaccgccaacttccagggcgaggcccag
gccccgcagaacctgaccgcgatcatccgcgccgacctgacgcgcagcgggcgcctgcgc
aatgtcgatccgggcggcgccacggtggcggaatccgccaatgtcgacctgggcagctgg
aagtcgcgcggcgccgatgccttcgtcgccggcagcgtgaccccggccgccggcggcaag
tatgaggtccgcttccgcctgtacgacaccgtcaagggccagagcctgggcgggctggcc
tttaccgtcaaccagtcccagctgcgcgtgaccgcgcacaagatcgccgactacatctat
gaaaagctgctgggcgagcgcggcgtgtttgccacgcgcctgtcctacgtgtcgaaggtg
ggcggccgctaccagctgctgatttccgactcggacggccagaacgcgcaggtggcgctg
accagcaacgagccgatcatctcgccgtcgtggtcgccggacggcgcgcgcgtggcctat
gtctcgttcgaggccaagaagccggtggtgtatgtgcacgacctggccagcggcaagcgc
acgctggtgtcgaaccagaagggcaacaacagcgcgccgtcgtggtcgcctgacggccag
cacctggcactggcgctgtcgcgcgacggcaatacccaggtctaccaggtcaatgccgac
ggctccggcgtccgccgcctgtcccgcagcagtgccatcgacaccgagccgcagtactcg
cccgacggcaagagcatctacttcaccagcgaccgcggcggtgcgccgcaggtttaccgc
atgcccgcttccggcgaggaaggtggcggtgcgcaacgtgtcaccttcaagggcagctac
aacgtgagcccgcgtatttcgccggacggcaagtacctggcgtacatctcgcgcacgggc
ggcttcaagctgcagctgcaggacctgagcaacggcgacgtgacgtcgctgaccgatacg
gccaacgacgaagcgcccagctttgccgccaacggcaagtacatcctctatgccacccga
gtgggcggtcgcgcggtgctggcggcggtttccactgacgggcgtacccggcaggttctg
tccctccagtccggcgatgttcgcgagccgtcctggggtcctttcatgcaataa

DBGET integrated database retrieval system