KEGG   Cupriavidus necator N-1: CNE_1c27360Help
Entry
CNE_1c27360       CDS       T01564                                 

Gene name
exbB2
Definition
(GenBank) biopolymer transport protein ExbB
  KO
K03562  biopolymer transport protein TolQ
Organism
cnc  Cupriavidus necator N-1
Pathway
cnc01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cnc00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cnc02000]
    CNE_1c27360 (exbB2)
Transporters [BR:cnc02000]
 Other Transporters
  Pores ion channels [TC:1]
   CNE_1c27360 (exbB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MotA_ExbB
Motif
Other DBs
NCBI-ProteinID: AEI78050
UniProt: G0ET44
Position
1:complement(2836957..2837640)
Genome map
AA seq 227 aa AA seqDB search
MNPVTVTQDMSIVTLVLHASLLAQAVMVLLLVMSLFSWTYIFRKHLAVRSARTQTEGFER
DFWAGGDLQALYNSAVNNRHNTGALERIFESGMGEFLKARERGNEAGALLDAARRAMRAA
YQREMDVLESHLPFLASVGSVSPYIGLFGTVWGIMNAFRGLSNVQQATLASVAPGIAEAL
VATAIGLFAAIPAVIAYNRYATEIDRLAIRFESFMEEFLNILQRQAR
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgaatcccgtgaccgtcacgcaagacatgtcgatcgtaacgctggtgctccacgccagc
ctgctggcacaggccgtcatggtgctgttgctcgtcatgtccctattttcgtggacctat
atcttccgcaagcacctggcggtgcgctcagcacgcacccagaccgaggggttcgaacgc
gacttctgggccggcggcgacctgcaggcgctatataacagtgccgtcaacaaccgccac
aacaccggcgcgctggagcggatctttgaatccggcatgggcgagttcctgaaggcgcgc
gagcgcggcaacgaagccggcgcgctgctcgatgcggcccggcgcgcgatgcgcgcggcc
taccagcgcgagatggatgtgctggaatcgcatctgccgttcctggcgtcggtgggttcg
gtgagcccgtatatcggcctgttcggcacggtatgggggatcatgaacgcattccgcggc
ctgtcgaatgtgcagcaggcgacgctcgcatcggtggcccccggtattgccgaggcgctg
gtggcgaccgcgatcggcctgttcgcggcgattccggcggtgatcgcctacaaccgctat
gccacggagatcgaccgcctggcgatccggttcgagagcttcatggaagagttcctgaac
atcctgcaacggcaggcacgctaa

DBGET integrated database retrieval system